KEGG   Pan troglodytes (chimpanzee): 100610501Help
Entry
100610501         CDS       T01005                                 

Gene name
USP31, USP48
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100610501 (USP31)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100610501 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1358 aa AA seqDB search
MSKVTAPGSGPPAAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSPSSPSS
PSSARSVGSFMSRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPAAAPTPPPCPPPPASP
APPACAAEPVPGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQ
PAGRGAQGQGEVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEFLL
WLLDRVHEDLNHSVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQELFQAQYRSSLTCPH
CQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAIPLSGTVARLREAVS
METKIPTDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIH
LNNNLNHLKFGLDYHRLSSPTQTAAKQGKMDLPTSRAGSDKIVLLVCNRACTGQQGKRFG
LPFVLHLEKTIAWDLLQKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEQPL
CHPTVERALKSCGPGGTAHVKLVVEWDKETRDFLFVNTEDEYIPDAESVRLQRERHHQPQ
TCTLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDR
RMKLQNMVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCN
HHGTMQGGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSAN
SSVAGSTSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFST
RPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSAS
TLEKIGEAADDKVSISCFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDESD
TRRLNSSVVDTQSKHSAQGDRLPPLSCPFDNNSQIAYVDQSDSVDSSPVKEVKPPSHPGS
LAKKPESTTKRSPSSKGTSEPEKSLRKGRPALASQESSLSSTSPSSPLPVKVSLKPSRSR
SKADSSSRGSGRHSSPAPAQPKKESSPKSQDSVSSPSPQKQKSASALTYTASSTSAKKAS
GPATRSPFPPGKSRTSDRSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGRGAGK
HVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKA
GGSSVKSVCKNTGDDKAERGHQPPASQQPNANTTGKEQLVSKDPASAKHSLLSARKSKSS
QLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaacggcgcctggttccgggccgccggcggcggcgagcgggaaggagaag
cgctccttcagcaagcggctgtttcggagcggccgcgctggcggcggcggcgcggggggc
cccggggcgtccgggccggccgcgccctcctcgccgtcctcgccgtcctcgccctcctcg
ccttcctctgcacgctcggtgggcagcttcatgagccgcgttctcaagacgctgtccacg
ctctcgcaccttagctctgagggcgccgccccagaccgcggcggcctccgcagctgcttc
ccgcccgggccggccgccgcgcccacgccgccgccgtgcccgccgccgcccgcctctccc
gcgccgcccgcttgcgccgccgagccggtgcccggcgtggcggggctccgcaaccacggc
aacacgtgcttcatgaacgccacgctgcagtgcctcagcaacaccgagctcttcgccgag
tacctggcgctgggccagtaccgggcggggcggcccgagccctcgcctgacccggagcag
cctgcgggccgcggcgcgcagggccagggcgaggtgactgagcagctggcgcacctggtg
cgggccctctggaccctggagtacaccccgcagcacagccgcgacttcaagactattgtg
tcaaagaatgcactgcagtaccggggaaattcccagcatgatgcccaggagtttctgctg
tggcttttggaccgagttcatgaagacctcaaccattcagtgaagcagagtggccagcct
cctctgaagccaccatcagagactgatatgatgcctgagggaccatcttttcctgtctgt
agcacttttgtacaagaactctttcaagcgcaatacagatcttctttgacgtgtcctcat
tgtcagaaacagagcaacacttttgatcctttcctttgcatttctttgccaattcctcta
ccccacacaaggcctctctatgtcactgtagtgtatcaaggcaaatgttctcactgcatg
aggattggtgtggccatacctctgtctgggactgtcgccagacttcgggaagcagtgtct
atggaaacaaagatccccactgatcagattgtgttaacagaaatgtactatgatgggttc
catcgttccttttgtgatacagacgacctggaaacagtccatgaaagcgactgcattttt
gcctttgagactcctgaaatatttaggcctgaaggaattctcagtcaaagaggaattcat
ttaaacaacaacctaaaccacttgaaatttggcttggattatcatagactgtcttctcct
acacaaacagcagcaaagcaagggaaaatggatttgcccacatcaagagcaggcagcgac
aagattgtcctgttggtgtgtaaccgagcctgcactgggcaacaagggaaaagatttgga
ctgccttttgtgctgcacttagagaagacaatagcttgggaccttctgcagaaggaaatc
ttggagaagatgaagtatttcttgaggcccacggtttgcattcaggtgtgtccattcagc
ttgcgtgtggtcagtgttgttggaataacatatttgctgccccaggaggagcagcccttg
tgccacccaacagtagaaagggcattaaaatcttgtggaccaggtggcaccgctcatgtg
aaattagtagtcgagtgggacaaggagacaagagatttcttgtttgtaaataccgaggat
gagtatattcctgatgcagaaagtgttcgtctgcaaagggagcgtcatcatcagcctcaa
acctgcactttatcccagtgtttccaactgtacaccaaagaggagcggcttgcccccgat
gatgcctggcgttgcccacactgtaagcagctgcagcagggaagcattacgttaagcctc
tggactctgcctgatgtgcttattatacatctaaagagatttcggcaggaaggagacagg
cgcatgaaacttcagaacatggtcaagttcccgttgactggcctggacatgacacctcat
gtggttaagaggagccagagcagctggagtttgccatcgcattggtccccgtggagacgg
ccctatggactcgggagggaccctgaggactacatctatgacctgtatgctgtgtgcaat
caccatggcaccatgcaaggggggcactacacagcgtactgtaagaactctgtggacggc
ctctggtactgcttcgatgacagcgatgtgcagcagctgtcagaagatgaggtctgcacg
cagacagcatacatcctcttctaccagaggcggacagccatcccgtcatggtcagccaac
agctcggtggcaggctccacaagttcttccctgtgtgaacactgggtgagccggctcccg
ggcagcaagccagccagcgtgacctctgcagcttcctccagacgcacctccctggcgtcg
ctctctgagtccgtggagatgactggagaaaggagtgaagatgatggaggcttttcaact
cgaccatttgtgagaagtgtccagcgtcagagtttgtcatccagatcttctgtcaccagc
cccttggcggtcaatgaaaattgcatgagaccttcatggtccctgtctgctaagctgcag
atgcgctccaattctccatcccgattttcaggggattcgccaattcacagctctgcttcc
accttggagaagattggggaggcagcagatgacaaggtctccatctcttgctttggtagc
ttgcggaacctttctagcagttaccaggaaccaagcgacagtcatagtcgccgtgagcac
aaggctgtgggccgggcccctctggctgtcatggaaggcgtgttcaaagacgaatcggac
acccgcagattgaactccagtgtcgtagatacacagagcaaacattcagcacaaggggac
cgcctgcccccgctctcttgtccatttgataacaatagtcagatcgcttatgtggatcag
agcgactccgtagacagctctccagtcaaagaggtgaaaccccccagccacccaggctca
ctcgcaaagaaaccagagagcacaactaagagatcccccagttccaaaggcacttctgag
ccagagaaaagcttgcggaaggggagaccagccttggcaagccaggagtcatccctttca
agtacatccccttcttctcctcttcctgtaaaagtctctctaaagccctcccgctcccgc
agcaaagcagattcttcttccaggggcagtggacggcattcatcccctgcccctgctcaa
cccaaaaaggagtcatccccgaaatctcaggactccgtgtcatctccttcgccacagaag
cagaagtcagcctcggccctcacctacactgcttcctccacatctgccaaaaaggcctcg
ggccctgccacaaggagccctttcccacctgggaagagcaggacttcagaccggagcttg
agtagagagggctccagacaaagcttgggttctgacagagccagcgccacctccacctcc
aaacccaactcccctcgggtgagccaggcccgagcaggggagggcaggggggccgggaag
cacgtgcggagctcctccatggccagcctgcgctcccccagcacaagcatcaagtctggt
ttgaagagggacagcaagtctgaggacaaggggctgtccttcttcaaatcagccttgaga
cagaaggaaacccggcgctcgacggatcttggcaagacagccttgctctctaaaaaggct
ggtgggagctctgttaagtccgtctgtaagaacaccggggacgacaaggcagagagaggc
caccagcctccagcttcccagcagccaaatgcaaatacgacgggaaaagagcagcttgtc
tccaaggaccctgcttctgccaaacattccctgctgtccgctcgcaaatccaagtcttcc
caactagactctggagttccctcgtctccgggtggcaggcagtctgcagagaaatcctca
aaaaagttatcttctagcatgcaaacctctgcacggccttctcaaaaacctcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system