KEGG   Pan troglodytes (chimpanzee): 100610515Help
Entry
100610515         CDS       T01005                                 

Gene name
HDAC6
Definition
histone deacetylase 6
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Substance dependence; Alcoholism [PATH:ptr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 1266 aa AA seqDB search
MSGANRGRGQASSTMTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPN
LAEVKKKGKMKKLGQAMEEDLIVGLQGMELNLEAEALAGTGLVLDEQLNEFHCLWDDSFP
EGLERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRV
LADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYC
MFNHVAVAARYAQQKHRIRRSATEGRWFLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYE
QGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLV
LVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASL
HTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESE
EEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGL
AGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACA
QLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQAISGH
ALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGF
TVNVAWNGPRMGDADYLAAWHRLVLPIAYEMPGPHLSLSAISMSLSLHLFLLPLSLYFFS
SLLHFQSLLLCLLVSRFCVSIPLTCISMSSFVLFSMSLGRHHLLPTKSPYPHAYTSLLSL
SGQWLLYDVRPGVPGQCEDGFLYGMKGGLGRQDMLSSKFPNEPPPYLSLPFSLTKGGYNL
TSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREG
PSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTKSETAVVA
LTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQ
TTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLA
SSTDHQTTPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQ
DMADSMLMQGSRGLTDQVSSGRGWDCYIGVDNSLSPALFLPPPHVLLDVKNIAHQNKFGE
DMPHPH
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagcgaaccgcggcaggggccaagcctcctcaactatgacctcaaccggccag
gattccaccacaaccaggcagcgaagaagtaggcagaacccccagtcgccccctcaggac
tccagtgtcacttcgaagcgaaatattaaaaagggagccgttccccgctctatccccaat
ctagcggaggtaaagaagaaaggcaaaatgaagaagctcggccaagcaatggaagaagac
ctaatcgtgggactgcaagggatggagctgaaccttgaggctgaagcactggctggcact
ggcttggtgttggatgagcagctaaatgaattccattgcctctgggatgacagcttcccg
gaaggccttgagcggctccatgccatcaaggagcaactgatccaggagggcctcctagat
cgctgcgtgtcctttcaggcccggtttgctgaaaaggaagagctgatgttggttcacagc
ctagaatatattgatctgatggaaacaacccagtacatgaatgagggagaactccgtgtc
ctagcagacacctacgactcagtttatctgcatccgaactcatactcctgtgcctgcctg
gcctcaggctctgtcctcaggctggtggatgcggtcctgggggctgagatccggaatggc
atggccatcattaggcctcctggacatcacgcccagcacagtcttatggatggctattgc
atgttcaaccacgtggctgtggcagcccgctatgctcaacagaaacaccgcatccggagg
tcagcaacagagggcagatggttccttatcgtagattgggatgtgcaccacggtcaagga
acacagttcacnttcgaccaggaccccagtgtcctctatttctccatccaccgctacgag
cagggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaa
ggccaaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactac
attgctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtc
ctggtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccact
ccggcagggttcgcccaactaacccacctgctcatgggtctggcaggaggcaagctgatc
ctgtctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctc
cacacccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagt
gcccaggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtg
agatcaactgagaccgtggagagggacaacatggaggaggacaatgtagaggagagcgag
gaggaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtct
cgcacagggctggtctatgaccaaaatatgatgaatcactgcaacttgtgggacagccac
caccctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggcctt
gccgggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgt
cacagtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctg
caccgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgca
cagcttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctg
aatggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggt
ttttgctttttcaactctgtggctgtggctgctcgccatgcccaggctatcagtgggcat
gccctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatg
tttgaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttc
ttccccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttc
accgtcaacgtggcatggaacgggccccgcatgggtgacgctgactacctagctgcctgg
catcgcctggtgcttcccattgcctacgagatgcccggcccccatctgtccctttctgcc
atctccatgtctctaagtctgcatctatttcttctacctctgagtctgtatttcttttct
tcccttcttcattttcagtctctgcttttgtgtctcctagtctccaggttctgtgtctcc
atccctctgacttgcatctccatgtcttcatttgtccttttctccatgtctctgggtcgc
catcacttactgcctaccaaaagcccctaccctcatgcttatacatctcttctctccctg
tcaggtcagtggttactgtatgatgtgaggccaggggttcctggacagtgtgaagacgga
tttctgtatggcatgaagggaggattggggaggcaggacatgttgtcctccaaattcccc
aatgaacccccaccatacctttccctccccttttccttaacaaagggtggctataacctg
acatccatctcagagtccatggctgcctgcactcgctccctccttggagacccaccaccc
ctgctgaccctgccacggcccccactatcaggggccctggcctcaatcactgagaccatc
caagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaagacagagaagga
ccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaacctaggttagct
gagcggatgaccacacgagaaaagaaggttctggaagcaggcatggggaaagtcacctcg
gcatcatttggggaagagtccactccaggccagactaagtcagagacagctgtggtggcc
ctcactcaggaccagccctcagaggcagccacagggggagccactctggcccagaccatt
tctgaggcagccattgggggagccatgctgggccagaccacctcagaggaggctgtcggg
ggagccactccggaccagaccacctcagaggagactgtgggaggagccattctggaccag
accacctcagaggatgctgttgggggagccacgctgggccagactacctcagaggaggct
gtaggaggagctacactggcccagaccacctcggaggcagccatggagggagccacactg
gaccagactacgtcagaggaggctccagggggcaccgagctgatccaaactcctctagcc
tcgagcacagaccaccagaccaccccaacctcacctgtgcagggaactacaccccagata
tctcccagtacactgattgggagtctcaggaccttggagctaggcagcgaatctcagggg
gcctcagaatctcaggccccaggagaggagaacctactaggagaggcagctggaggtcag
gacatggctgattcgatgctgatgcagggatctaggggcctcactgatcaggtgagctca
gggagaggctgggactgttacattggggtggataactctctctcacctgccctattcttg
cctcctcctcacgttctcctagatgtgaagaacatcgcccaccagaacaagtttggggag
gatatgccccacccacactaa

DBGET integrated database retrieval system