KEGG   Pan troglodytes (chimpanzee): 100611162Help
Entry
100611162         CDS       T01005                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ptr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ptr04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:ptr04510]
Human Diseases; Cancers; Pathways in cancer [PATH:ptr05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:ptr05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ptr05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ptr05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 460 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCD
NT seq 1382 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgcttctgctggggctggcgctactggcaccgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcgggggctcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctagggaaggcttacgagatcacgtatgtgaggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactattat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgtggcgggccagttggcctgccggtgccagcacaacaccaccggcacagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgtttgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgac
ag

DBGET integrated database retrieval system