KEGG   Pan troglodytes (chimpanzee): 100611162Help
Entry
100611162         CDS       T01005                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100611162 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100611162 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100611162 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100611162 (LAMC3)
   05222 Small cell lung cancer
    100611162 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100611162 (LAMC3)
   05145 Toxoplasmosis
    100611162 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 460 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCD
NT seq 1382 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgcttctgctggggctggcgctactggcaccgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcgggggctcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctagggaaggcttacgagatcacgtatgtgaggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactattat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgtggcgggccagttggcctgccggtgccagcacaacaccaccggcacagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgtttgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgac
ag

DBGET integrated database retrieval system