KEGG   Pan troglodytes (chimpanzee): 100611203Help
Entry
100611203         CDS       T01005                                 

Definition
profilin-1-like
Orthology
K05759  
profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100611203
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100611203
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100611203
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100611203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 66 aa AA seqDB search
MNGLTLGGQKYTVVLDSLLQDGELTTDLRMKSIGGAPTFNVIVTMTAKMLGLLMGKEGIH
GNFINK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggctgacactggggggccagaaatatactgtggtcctggattcactgctgcag
gatggggaattgaccacggatcttcgtatgaagagcatcggtggagcccccaccttcaac
gtcattgtcaccatgactgccaagatgctaggcctgctgatgggcaaagaaggtatccat
ggcaatttcatcaacaagtaa

DBGET integrated database retrieval system