KEGG   Pan troglodytes (chimpanzee): 100611207Help
Entry
100611207         CDS       T01005                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100611207 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100611207 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100611207 (PFN4)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100611207 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2A
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR
REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
acgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaagcccga
agagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtggttgttgtgaagacccatctatatcttctg
gtggcaacttacactgagggcatgtatcctagcatctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system