KEGG   Pan troglodytes (chimpanzee): 100611292Help
Entry
100611292         CDS       T01005                                 

Gene name
USP34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100611292 (USP34)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100611292 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2A
AA seq 3395 aa AA seqDB search
MRRKNSYYVWQKXFQIQFPLYTAYKHNTHPTIEDISTQESNILGAFCDMNDVEVPLHLLR
YVCLFCGKNGLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTY
VIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRL
AGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLISNNVVEHIFGPNLHIEIIKQC
QVILNFLAAEGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSAL
EPSVHTEQTLYLASMLIKALWNNALAAKAQLSKQSSFASLLNTNIPIGNKKEEEELRRTA
PSPWSPAASPQSSDNSDTHQSGGSDIEMDEQLINRTKHVQQRLSDTEESMQGSSDETANS
GEDGSSGPGSSSGHSDGSSNEVNSSHASQSAGSPGSEVQSEDIADIEALKEEDEDDDHGH
NPPKSSCGTDLRNRKLESQAGICLGDSQGTSERNGTSSGTGKDLVFNTESLPSVDNRMRM
LDACSHSEDPEHDISGEMNATHIAQGSQESCITRTGDFLGETIGNELFNCRQFIGPQHHH
HHHHHHHHHDGHMVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAE
LTSHLQQHLPNLASIYHEHLSQGPVVHKHQFNSNAVTDINLDNVCKKGNTLLWDIVQDED
AVNLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTF
QQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQTVREGRQKHALYSHSAEVQVRLQFL
TCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKH
LFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGCSNSELCGMDQFWGIALRAQSG
DVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSSLEQESHSSLMVIERGLLML
KTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPS
DQVADLRAEVTHWYENLQKEQINQQAQLQEFGQSNRKGEFPGGLMGPVRMISSGHELTTD
YDEKALHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLT
TLFDLLEMLASFKPPSGKVAVDDSESLRCEELHLHAENLSRRVWELLMLLPTCPNMLMAF
QNISDEQSNDGFNWKELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDD
SSEDQVENSKNSWSCKFVAAGGLQQLLEIFNSGILEPKEQESWTVWQLDCLACLLKLICQ
FAVDPSDLDLAYHDVFAWSGIAESHRKRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQG
TSLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCCSLVKSSLADSD
HLQDWLKKLTLLIPETAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQ
ALKPIRIDDYEEEPILKPGCKEYFWLLCKLVDNIHIKDASQTTLLDLDALARHLADCIRS
REILDHQDGNVEDDGLTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQ
QPKCKSHSSRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEDVRAEC
RFVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESE
CKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGGVITN
NVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRA
EKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKE
GFKEVSDHSKDSESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEV
KPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGREYKF
DVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSF
VLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQ
MFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDTSVEDIGGRSCVTRFVRTLLLIMEHG
VKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEE
GEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAALTGGKGFP
FLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLM
EFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERF
LLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVL
LGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPA
IATNHNKQALLSFWYNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGML
PAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFIAQRP
DMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRGLILM
TESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFA
HKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGP
YFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQFIHL
LCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLCEDP
VFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCANLISTLITNLISQYQN
LQSDFCNRVEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCLQQRN
SLQEQEAKERKTKDDEGATPIKRRRVSSDEEHTVDSCISDMKTETREVLTPTSTSDNETR
DSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDMSSIRSQHAEEQSNNGRYDDCKEFK
DLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLF
SHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
NT seq 10188 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggaaaaactcttactatgtgtggcaaaaantttttcaaattcagtttccctta
tatactgcttacaagcataatactcaccctactattgaggatatatcaactcaagaaagt
aacatattaggggcattctgtgatatgaatgatgtagaagtaccattgcatttgcttcgt
tatgtatgtttgttttgtgggaaaaatggcctttctctcatgaaggattgctttgaatat
ggaactcctgaaactttgccatttcttatagcacatgcgtttattacagttgtgtctaat
attagaatatggctacatattcctgctgtcatgcagcacattataccttttaggacctat
gttattaggtatttatgcaagctctcggatcaggagttacgacagagtgcagctcgtaac
atggctgacttaatgtggagcacagtcaaagaaccattggatacaacattatgctttgat
aaagaaagcctagatcttgcatttaagtactttatgtcacctactttgactatgaggttg
gctggattgagtcagataacaaatcaactccataccttcaatgatgtgtgcaataatgaa
tcattagtatcggacacagaaacgtccattgcaaaagaacttgcagactggcttattagc
aacaatgtggtggagcatatatttggaccaaatttacatattgagattatcaaacagtgc
caagtgattttgaattttttggcagcagaagggcgactgagtactcaacatattgactgt
atttgggctgcagcacagttgaaacattgtagtcggtatatacatgacttatttccttca
ctcatcaagaatttggatcctgtaccacttagacatctacttaatctggtctcagctctt
gagccaagtgttcatactgaacagacactgtacttggcatccatgttaattaaagcactg
tggaataacgcactagcagctaaggctcagttatctaaacagagttcttttgcatcttta
ttaaatactaatattcccattggaaataagaaagaggaagaagagcttagaagaacagct
ccatcaccttggtcacctgcagctagtcctcaaagcagtgataatagcgatacacatcaa
agtggaggtagtgacattgaaatggatgagcaacttattaatagaaccaaacatgtgcaa
caacgactttcagacacagaggaatccatgcagggaagttctgacgaaactgccaacagt
ggtgaagatggaagcagtggtcctggtagcagtagtgggcatagtgatggatctagcaat
gaggttaattctagccatgcaagccagtcagctgggagccctggcagtgaggtacagtca
gaagacattgcagatattgaagccctcaaagaggaagatgaagacgatgatcatggtcat
aatcctcccaaaagcagttgtggtacagatcttcggaatagaaagttagagagtcaagca
ggcatttgcctgggggactcccaaggcacgtcagaaagaaatgggacaagcagcggaaca
ggaaaggacctggtttttaacactgaatcattgccatcagtagataatcgaatgcgaatg
ctggatgcttgttcacactctgaagacccagaacatgatatttcaggggaaatgaatgct
actcatatagcacaagggtctcaggagtcttgtatcacacgaactggggacttccttggg
gagactattgggaatgaattatttaattgtcgacaatttattggtccacagcatcaccac
caccaccaccaccatcaccaccaccacgatgggcatatggttgacgatatgctaagtgca
gatgatgtcagttgtagtagctcccaggttagtgcaaaatcagaaaaaaatatggctgat
tttgatggtgaagaatctggatgtgaagaggagctagttcagattaattcacatgcggaa
ctgacatctcacctccaacaacatcttcccaatttagcttccatttaccatgaacatctt
agtcaaggacctgtagttcataaacatcaattcaacagtaatgctgttacagacatcaat
ttggataatgtttgcaagaaaggaaatactttgttgtgggatatagtccaagatgaagat
gcagttaatctttctgaaggattaataaatgaagcagagaaacttctttgttcgttagta
tgttggtttacagatagacaaattcgaatgagattcattgaaggttgccttgaaaacttg
ggaaacaacagatcagtagtaatttcacttcgtcttcttccaaaactatttggtactttt
cagcagtttgggagcagttacgatacacactggataacaatgtgggcagaaaaagaactg
aacatgatgaagcttttctttgataatttggtatactacattcaaactgtgagagaagga
agacaaaaacatgcactgtacagccatagtgctgaagttcaagttcgtcttcaattcttg
acttgtgtattttcaactctgggatcacctgatcatttcaggttaagtttagagcaagtt
gacatcttatggcattgtttagtagaagattctgaatgttatgatgatgcactccattgg
tttttaaatcaagttcgaagtaaagatcaacatgctatgggtatggaaacctacaaacat
cttttcctggagaagatgccccagctaaaacctgaaacaattagcatgactggcttaaac
ctgtttcagcatctctgtaacttggctcgattggctaccagtgcctatgatggttgttca
aattctgagctgtgtggtatggaccaattttggggcattgctttaagagcacaatctggt
gatgtcagtcgagcagctatccagtatattaactcctattatattaatggtaaaacaggt
ttggagaaggagcaagaatttattagtaagtgcatggagagtcttatgatagcttctagc
agtcttgaacaggaatcacactcaagtctcatggttatagaaagaggactccttatgctg
aagacacatctggaagcgtttaggagaaggtttgcatatcatctgagacagtggcaaatt
gaaggcactggtattagtagtcatttgaaagcactgagtgacaaacagtctctgccgcta
agggttgtatgccagccagctggacttcctgacaagatgactattgaaatgtatcctagt
gaccaggtagcagatcttagggctgaagtaactcattggtatgaaaatttacagaaagaa
caaataaatcaacaagctcagcttcaggagtttggtcaaagcaaccgaaaaggagagttt
cctggaggcctcatgggacctgtcaggatgatttcatctggacacgagttaacaacagat
tatgatgaaaaagcacttcatgagcttggttttaaggatatgcagatggtatttgtatct
ttgggtgcaccaaggagagaacggaaaggggaaggtgttcagctgccagcatcttgcctc
ccaccccctcagaaggacaacattccaatgcttttgcttttacaagagcctcatttaact
actctttttgatttattagagatgcttgcatcatttaaaccaccctcaggaaaagtggca
gtggatgatagtgagagcttacgatgtgaagaacttcatcttcatgcagaaaatctgtct
aggcgggtctgggagctactgatgcttcttcctacatgtcctaatatgttgatggcattc
cagaatatctcagatgagcagagtaatgatggatttaattggaaagaacttctcaaaatt
aagagcgcccacaagctattgtatgctctggaaattattgaagcactgggaaaacctaat
agaagaataaggagggagtctacgggaagttacagtgatctttatccagattcagatgat
tcaagtgaggatcaagtggaaaatagtaaaaattcctggagttgcaagtttgttgctgct
ggagggcttcaacagttattagaaatttttaattctggaattctagagcctaaagagcag
gaatcatggactgtgtggcagctagactgtcttgcttgcttgctgaagttaatatgccag
tttgcagtagatccatccgatttggatttagcttatcatgatgtctttgcctggtctggt
atagcggaaagccataggaaaagaacctggcctggcaaatcaaggaaggctgctggtgat
catgctaagggtcttcatataccacgattaacagaggtatttcttgttcttgtccaagga
accagtttgattcagcgacttatgtctgttgcttatacgtatgataatctggctcctaga
gttttaaaagctcagtctgatcacaggtctagacatgaagtttcacattattcaatgtgg
ctcttggtgagttgggctcattgctgttctttagtgaaatctagccttgctgatagtgat
catttacaagattggctaaagaaattgactctccttattcctgagactgcagttcgtcat
gaatcatgcaatggtctctataagttatccctgtcagggctggatggaggagactctatc
aatcgttcttttctgctattggctgcctcaacattattgaaatttcttcctgatgctcaa
gcactcaaacctattaggatagatgattatgaggaagaaccaatattaaaaccaggatgt
aaagagtatttttggttgttatgcaaattagttgacaacatacatataaaggacgctagt
cagacaacgctcctcgacttagatgccttggcaagacatttggctgactgtattcgaagt
agggagatccttgatcatcaggatggtaatgtagaagatgatgggcttacaggactccta
aggcttgcaacaagtgttattaaacacaaaccaccctttaaattttcaagggaaggacag
gaatttttgagagatatcttcaatctcctgtttttgttgccaagtctaaaggaccgacaa
cagccaaagtgcaaatcacattcttcaagagctgccgcttacgatttgttagtagagatg
gtaaaggggtctgttgagaactacaggctaatacacaactgggttatggcacaacacatg
cagtcccatgcaccttataaatgggattactggcctcatgaagatgtccgtgctgaatgt
agatttgttggccttactaaccttggagctacttgttacttagcttctactattcagcaa
ctttatatgatacctgaggcaagacaggctgtcttcactgccaagtattcagaggatatg
aagcacaagaccactcttctggagcttcagaaaatgtttacatatttaatggagagtgaa
tgcaaagcatataatcctagacctttctgtaaaacatacaccatggataagcagcctctg
aatactggggaacagaaagatatgacagagttttttactgatctaattaccaaaatcgaa
gaaatgtctccagaactgaaaaataccgtcaaaagtttatttggaggtgtaattacaaac
aatgttgtatccttggattgtgaacatgttagtcaaactgctgaagagttttatactgtg
aggtgccaagtggctgatatgaagaacatttatgaatctcttgatgaagttactataaaa
gacactttggaaggtgataacatgtatacttgttctcattgtgggaagaaagtacgagct
gaaaaaagggcatgttttaagaaattgcctcgcattttgagtttcaatactatgagatat
acatttaatatggtcacgatgatgaaagagaaagtgaatacacacttttccttcccatta
cgtttggacatgacgccctatacagaagattttcttatgggcaagagtgagaggaaagaa
ggttttaaagaagtcagtgatcattcaaaagactcagagagctatgaatatgacttgata
ggagtgactgttcacacaggaacggcagatggtggacactattatagctttatcagagat
atagtaaatccccatgcttataaaaacaataaatggtatctttttaatgatgctgaggta
aaaccttttgattctgctcaacttgcatctgaatgttttggtggagagatgacgaccaag
acctatgattctgttacagataaatttatggatttctcttttgaaaagacacacagtgca
tatatgctgttttacaaacgcatggaaccagaggaagaaaatggcagagaatacaaattt
gatgtttcgtcagagttactagagtggatttggcatgataacatgcagtttcttcaagac
aaaaacatttttgaacatacatattttggatttatgtggcaattgtgtagttgtattccc
agtacattaccagatcctaaagctgtgtccttaatgacagcaaagttaagcacttccttt
gtcctagagacatttattcattctaaagaaaagcccacgatgcttcagtggattgaactg
ttgacgaaacagtttaataatagtcaggcagcttgtgagtggtttttagatcgtatggct
gatgacgactggtggccaatgcagatactaattaagtgccctaatcaaattgtgagacag
atgtttcagcgtttgtgtatccatgtgattcagaggctgagacctgtgcatgctcatctc
tatttgcagccaggaatggaagatgggtcagatgatatggatacctcagtagaagatatt
ggcggtcgttcatgtgtcactcgctttgtgagaaccctgttattaattatggaacatggt
gtaaaacctcacagtaaacatcttacagagtattttgccttcctttacgaatttgcaaaa
atgggtgaagaagagagccaatttttgctttcattgcaagctatatctacaatggtacat
ttttacatgggaacaaaaggacctgaaaatcctcaagttgaagtgttatcagaggaagaa
ggggaagaagaagaggaggaagaagatatcctctctctggcagaagaaaaatacaggcca
gctgcccttgaaaagatgatagctttagttgctcttttggttgaacagtctcgatcagaa
aggcatttgacattatcacagactgacatggcagcattaacaggaggaaagggatttccc
ttcttgtttcaacatattcgtgatggcatcaatataagacaaacttgtaatctgattttc
agcctgtgtcgatacaataatcgacttgcagaacatattgtatctatgcttttcacatca
atagcaaagttgactcctgaggcagccaatcctttctttaagttgttgactatgctaatg
gagtttgctggtggacctccaggaatgcctccctttgcatcttatattctgcagaggata
tgggaggtgattgaatacaatccttctcagtgtctagattggttggcagtgcagacaccc
cgaaataaactggcacacagctgggtcttacagaatatggaaaactgggtcgagcggttt
cttttggctcacaattatcctagagtgaggacttctgcagcttatcttctggtgtccctt
ataccaagcaattcattccgtcagatgttccggtcaacaaggtctttgcacatcccaacc
cgtgaccttccactcagtccagacacaacagtagtcctacatcaggtctacaacgtgctc
cttggtttgctctcaagagccaaactttatgttgatgctgctgttcatggcactacaaag
ctagtgccctattttagctttatgacttactgtttaatttccaaaactgagaagctgatg
ttttccacatatttcatggatttgtggaaccttttccagcctaaactttctgagccagca
atagctacaaatcacaataaacaggctttgctttcattttggtacaatgtctgtgctgac
tgtccagagaatatccgccttattgttcagaacccagtggtaaccaagaacattgccttc
aattacatccttgctgaccatgatgatcaggatgtggtgctttttaaccgtgggatgctg
ccagcctactatggcattctgaggctctgctgtgagcagtctcctgcattcacacgacaa
ctggcttctcaccagaacatccagtgggcctttaagaatcttacaccacatgccagccaa
taccctggagcagtagaagaactgtttaacctgatgcagctgtttatagctcagaggcca
gatatgagagaagaagaattagaagatattaaacagttcaagaaaacaaccataagttgt
tacttacgttgcttagatggccgctcctgctggacaactttaataagtgccttcagaata
ctattagaatctgatgaagacagacttcttgttgtatttaatcgagggttgattctaatg
acagagtctttcaacactttgcacatgatgtatcacgaagctacagcttgccatgtgact
ggagatttagtagaacttctgtcaatatttctttcggttttgaagtctacacgcccttat
cttcagagaaaagatgtgaaacaagcattaatccagtggcaggagcgaattgaatttgcc
cataaactgttaactcttcttaattcctatagtcctccagaacttagaaatgcctgtata
gatgtcctcaaggaacttgtacttttgagtccccatgattttcttcatactctggttccc
tttctacaacacaaccattgtacttaccatcacagtaatataccaatgtctcttggacct
tatttcccttgtcgagaaaatatcaagctaataggagggaaaagcaatattcggcctccg
cgccctgaactcaatatgtgcctcttgcccacaatggtggaaaccagtaagggcaaagat
gacgtttatgatcgtatgctgctagactacttcttttcttatcatcagttcatccatcta
ttatgccgagttgcaatcaactgtgaaaaatttactgaaacattagttaagctgagtgtc
ctagttgcctatgaaggtttgccacttcatcttgcactgttccccaaactttggactgag
ctatgccagactcagtctgctatgtcaaaaaactgcatcaagcttttgtgtgaagatcct
gttttcgcagaatatattaaatgtatcctaatggatgaaagaacttttttaaacaacaac
attgtctacacgttcatgacacatttccttctaaaggttcaaagtcaagtgttttctgaa
gcaaactgtgccaatttgatcagcactcttattacaaacttgataagccagtatcagaac
ctacagtctgatttctgcaaccgagttgaaatttccaaagcaagtgcttctttaaatggg
gacctgagggcactcgctttgctcctgtcagtacacactcccaaacagttaaacccagct
ctaattccaactctgcaagagcttttaagcaaatgcaggacttgtctgcaacagagaaac
tcactccaagagcaagaagccaaagaaagaaaaactaaagatgatgaaggagcaactccc
attaaaaggcggcgtgttagcagtgatgaggagcacactgtagacagctgcatcagtgac
atgaaaacagaaaccagggaggtcctgaccccaacgagcacttctgacaatgagaccaga
gactcctcaattattgatccaggaactgagcaagatcttccttcccctgaaaatagttcc
gttaaagaataccgaatggaagttccatcttcgttttcagaagacatgtcaagtatcagg
tcacagcatgcagaagaacagtccaacaatggtagatatgacgattgtaaagaatttaaa
gacctccactgttccaaggattctaccctagctgaggaagaatctgagttcccttctact
tctatctctgcagttctgtctgacttagctgacttgagaagctgtgatggccaagctttg
ccctcccaggaccctgaggttgctttatctctcagttgtggccattccagaggactcttt
agtcatatgcagcaacatgacattttagataccctgtgtaggaccattgaatctacaatc
catgtcgtcacaaggatatctggcaaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system