KEGG   Pan troglodytes (chimpanzee): 100611877Help
Entry
100611877         CDS       T01005                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100611877 (USP26)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100611877 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 817 aa AA seqDB search
MASLFLRGFVQIGNCKTGISKSKEAFIEAVERKKEDRLVLYFKSGKYITFRLSDNIQNVV
LKSYRGNQNHLHLTLQNNNVLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFS
STTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRIPLLISKSSTLTCGELSENQHK
KRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKSKELEENKKLECESS
CIMNATGNPYLDDIGLLQALTEKMVLAFLLQQGYSDGYTKWDKLKLFFELFPEKICHGLP
NLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFLKDIYNIEIKE
IHPSSIQYSFDLFFEAEELEYKCAKCEHKTSVGVHXFSRLPRIVSVHLKRYSXDEFFALK
KNDQEVIISKYVKVSSHCNEGTRPRLPLSEEGEITDFQLLKVIRKMTSGNISVSWPATKE
SKDILAXHIGSDKEFEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEP
LAHLLTYLEDTSLCQFHKAGGKPASSPGTPLSKVHFQTVPENPKQKKYVKTSKFVAFDRI
INPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLL
RPTKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHL
GKTLKSGHYICDAYDFEKQIWFTYDDMQVLGSRRIHAENKEHGVADLYEYHFLQRLARTS
PNMREWHGEHYTETLDQYQKDREKVPVEVNSINLNKD
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctattcctacgtggttttgtccaaatagggaactgcaagactgggatatct
aagtcaaaagaagcattcattgaagcagtggaaagaaagaaggaagatagactggtgctg
tatttcaaaagtggaaaatatatcacttttcggctaagtgataatattcaaaatgtagtc
cttaaatcctatagaggaaaccaaaatcacctgcatttaactttacaaaataataatgtc
ttgtttattgaaggattatcctccacagatgctgaacaattgaagatattcttggacaga
gttcatcaaaacgaggttcagccacctgtgagacctggtaagggtgggagtgtcttttct
agcacaacaacacagaaggaaatcaacaaaacttcattccacaaagttgatgagaaatca
agtagcaaatcttttgagatagcaaaaggaagtgggacaggtgtccttcagaggatacct
ttgcttatatcaaaatcatcaacacttacttgcggagagttatcagaaaatcagcacaag
aagaggaaaagaatgctctcatctagctcagagatgaatgaggaattcttgaaagaaaat
aattctgtagaatacaagaaatccaaggcagattgttcgaggtgtgtaagctataatcga
gagaaacaattgaagtcaaaagagttagaagagaataagaaattggaatgtgaatcttca
tgcatcatgaacgccactggaaatccttacctagatgacattggacttctccaagctctc
actgagaaaatggttttggcatttctgttacaacaagggtatagtgatggttacacaaag
tgggataaattaaaactattttttgaattatttccagagaaaatatgccacggcctcccc
aatttgggaaacacctgttatatgaatgcagtgttacagtctctactttcaatcccatcg
tttgctgatgatttacttaatcagagtttcccatggggtaaaattccccttaatgctctt
accatgtgcttggcacggctactttttttaaaagatatctataatatagaaatcaaggag
atacatccttcgtctattcagtatagttttgatctcttttttgaagcagaggaacttgag
tataaatgtgcaaaatgtgagcacaagacttctgttggagtgcactgattcagtaggcta
cctagaatcgttagtgttcacctcaaacgctatagctgagatgagttttttgcattaaag
aagaatgaccaggaagtcatcatttccaaatatgtaaaggtgtcttctcattgcaatgaa
ggcaccagaccacgtcttcccttgagtgaggagggagaaattacagatttccaattatta
aaagttattcgaaagatgacttctggaaacatcagtgtatcatggcctgcaacaaaggaa
tccaaagatatcctggctncacacattggatcagataaggagtttgaacaaaaaaaaggc
cagacagtctttaaaggggcaagcagaagacagcagcaaaagtaccttggaaaaaattct
aaaccaaatgagctagaatctgtatactcaggagatcgagcattcattgaaaaagaaccg
ttagctcacttattgacgtatctggaagatacctcactttgtcagttccacaaagctgga
ggtaaacctgccagcagcccaggcacacctctctcaaaagttcactttcaaacagtgccc
gaaaatccaaaacaaaagaaatatgtgaaaaccagtaagtttgtagcttttgataggatt
atcaatcctactaaagatttgtatgaagataaaaatatcagaattccagaaagattccaa
aaagtgtctgaacagactcagcagtgtgacggtatgagaatctgtgaacaagcccctcag
caggcactgcctcaaagctttccaaagccaggcacccaggggcacacaaagaacctccta
agacctacaaaattaaatctacagaagtctaacaggaattccctacttgcactgggttcc
aataagaatccaagaaacaaagacattttagataagataaaatctaaagccaaggaaaca
aaaagaaatgatgataagggagatcatacctaccggctcattagtgttgtcagccatctt
gggaagactctaaagtcaggccattatatctgtgatgcctatgactttgagaaacagatc
tggttcacttacgatgatatgcaggtgttaggatccaggaggatacatgcagagaataag
gaacacggggtggcagatttgtatgaataccattttctgcaacgtctggcaagaacaagc
ccaaatatgagagaatggcatggagagcactacactgagactttggaccaataccaaaaa
gatagagaaaaggttccagttgaagtgaattcaattaacctcaacaaggattaa

DBGET integrated database retrieval system