KEGG   Pan troglodytes (chimpanzee): 100611992Help
Entry
100611992         CDS       T01005                                 

Gene name
UGT2B11
Definition
UDP glucuronosyltransferase 2 family, polypeptide B11
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100611992 (UGT2B11)
   00053 Ascorbate and aldarate metabolism
    100611992 (UGT2B11)
   00500 Starch and sucrose metabolism
    100611992 (UGT2B11)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100611992 (UGT2B11)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100611992 (UGT2B11)
   00860 Porphyrin and chlorophyll metabolism
    100611992 (UGT2B11)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100611992 (UGT2B11)
   00982 Drug metabolism - cytochrome P450
    100611992 (UGT2B11)
   00983 Drug metabolism - other enzymes
    100611992 (UGT2B11)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100611992 (UGT2B11)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100611992 (UGT2B11)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   100611992 (UGT2B11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 529 aa AA seqDB search
MALKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKESFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKLMKKLQESRFDIIFADAFFPCGELLAELFNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWNFQFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSIISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGISMVGIPLFFDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVTFIITKCCLFCFWKFTRKVKKEKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaatggacttcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaggtgctggtgtgggccgcagaatacagccattggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcatccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagaaagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaacttatgaaaaaacta
caagagtcaagatttgacatcatttttgcagatgctttttttccttgtggtgagctgctg
gctgagctatttaacataccctttgtgtacagtctctgctttactcctggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtgtgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggctaatgcgaaac
tcctggaattttcagtttcctcatccattcttaccaaacgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatcataagtaacatgacagcagaaagg
gccaatgtaatagcaacagccctggccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcgatctaccatgggatctctatggtgggcattccattgttttttgatcaacct
gataatattgctcacatgaaggccaagggagcagctgttagattggacttccacacaatg
tcaagtacagacttgttgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatagagca
gtcttctggattgaatttgtcatgcgccacaaaggagccaaacaccttcgagttgcagcc
cgtgacctcacctggttccagtaccactctttggatgtgattgggtttctgctagcctgt
gtggcaactgtgacatttatcatcacaaagtgttgtctgttttgtttctggaagtttact
agaaaagtgaagaaggaaaaaagagattag

DBGET integrated database retrieval system