KEGG   Pan troglodytes (chimpanzee): 100611992Help
Entry
100611992         CDS       T01005                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B11
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00040  Pentose and glucuronate interconversions
ptr00053  Ascorbate and aldarate metabolism
ptr00140  Steroid hormone biosynthesis
ptr00830  Retinol metabolism
ptr00860  Porphyrin and chlorophyll metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Module
ptr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100611992
   00053 Ascorbate and aldarate metabolism
    100611992
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100611992
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100611992
   00860 Porphyrin and chlorophyll metabolism
    100611992
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100611992
   00982 Drug metabolism - cytochrome P450
    100611992
   00983 Drug metabolism - other enzymes
    100611992
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100611992
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100611992
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   100611992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100611992
NCBI-ProteinID: XP_003310407
Ensembl: ENSPTRG00000016110
UniProt: H2RBQ3
Position
4
AA seq 529 aa AA seqDB search
MALKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKESFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKLMKKLQESRFDIIFADAFFPCGELLAELFNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWNFQFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSIISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVTFIITKCCLFCFWKFTRKVKKEKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaatggacttcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaggtgctggtgtgggccgcagaatacagccattggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcatccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagaaagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaacttatgaaaaaacta
caagagtcaagatttgacatcatttttgcagatgctttttttccttgtggtgagctgctg
gctgagctatttaacataccctttgtgtacagtctctgctttactcctggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtgtgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggctaatgcgaaac
tcctggaattttcagtttcctcatccattcttaccaaacgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatcataagtaacatgacagcagaaagg
gccaatgtaatagcaacagccctggccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcgatctaccatgggatccctatggtgggcattccattgttttttgatcaacct
gataatattgctcacatgaaggccaagggagcagctgttagattggacttccacacaatg
tcaagtacagacttgttgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatagagca
gtcttctggattgaatttgtcatgcgccacaaaggagccaaacaccttcgagttgcagcc
cgtgacctcacctggttccagtaccactctttggatgtgattgggtttctgctagcctgt
gtggcaactgtgacatttatcatcacaaagtgttgtctgttttgtttctggaagtttact
agaaaagtgaagaaggaaaaaagagattag

DBGET integrated database retrieval system