KEGG   Pan troglodytes (chimpanzee): 100613118Help
Entry
100613118         CDS       T01005                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04020  Calcium signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04114  Oocyte meiosis
ptr04218  Cellular senescence
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04720  Long-term potentiation
ptr04724  Glutamatergic synapse
ptr04921  Oxytocin signaling pathway
ptr04922  Glucagon signaling pathway
ptr04924  Renin secretion
ptr05010  Alzheimer's disease
ptr05014  Amyotrophic lateral sclerosis (ALS)
ptr05031  Amphetamine addiction
ptr05152  Tuberculosis
ptr05166  HTLV-I infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100613118 (PPP3R1)
   04310 Wnt signaling pathway
    100613118 (PPP3R1)
   04370 VEGF signaling pathway
    100613118 (PPP3R1)
   04020 Calcium signaling pathway
    100613118 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    100613118 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100613118 (PPP3R1)
   04218 Cellular senescence
    100613118 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100613118 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    100613118 (PPP3R1)
   04660 T cell receptor signaling pathway
    100613118 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    100613118 (PPP3R1)
   04659 Th17 cell differentiation
    100613118 (PPP3R1)
   04662 B cell receptor signaling pathway
    100613118 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    100613118 (PPP3R1)
   04921 Oxytocin signaling pathway
    100613118 (PPP3R1)
   04924 Renin secretion
    100613118 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    100613118 (PPP3R1)
   04720 Long-term potentiation
    100613118 (PPP3R1)
  Development
   04360 Axon guidance
    100613118 (PPP3R1)
   04380 Osteoclast differentiation
    100613118 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100613118 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100613118 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    100613118 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    100613118 (PPP3R1)
   05166 HTLV-I infection
    100613118 (PPP3R1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100613118 (PPP3R1)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100613118 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100613118
NCBI-ProteinID: XP_003309092
Ensembl: ENSPTRG00000041941
UniProt: K7BDX2
Position
2A
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaaattgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system