KEGG   Pan troglodytes (chimpanzee): 100613803Help
Entry
100613803         CDS       T01005                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100613803 (RBKS)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100613803 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2A
AA seq 322 aa AA seqDB search
MAASGESQRQWXEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCV
QAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNI
IVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAP
AIADLDPRFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEG
CVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAV
SVQAAGTQSSYPYKKDLPLTLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctggggaatcccagaggcagtggncagaggaggtggcggcggtggtagtg
gtgggctcctgcatgaccgacctggtcagtcttacttctcgtttgccaaaaactggagaa
accatccatggacataagttttttattggctttggagggaaaggtgccaaccagtgtgtc
caagctgctcggcttggagcaatgacgtccatggtatgtaaggttggcaaagattctttt
ggcaatgattatatagaaaacttaaaacagaatgatatttctacagaatttacatatcag
actaaagatgctgctacaggaactgcttctataattgtcaataatgaaggccagaatatc
attgtcatagtggctggagcaaatttacttttgaatacggaggatctgagggcagcagcc
aatgtcattagcagagccaaagtcatggtctgccagctcgaaataactccagcaacttct
ttggaagccctaacaatggcccgcaggagtggagtgaaaaccttgttcaatccagcccct
gccattgctgacctggatccccggttctacaccctctcagatgtgttctgctgcaatgaa
agtgaggctgagattttaactggcctcacggtgggcagcgctgcagatgctggggaggct
gcattagtgctcttgaaaaggggctgccaggtggtaatcattaccttaggggctgaagga
tgtgtggtgctgtcacagacagaacctgagccaaagcacattcccacagagaaagtcaag
gctgtggataccacgggtgctggtgacagctttgtgggagctctggccttctacctggct
tactatccaaatctgtccttggaagacatgctcaacagatccaatttcattgcagcagtc
agtgtccaggctgcaggaacacagtcatcttacccttacaaaaaagaccttccgcttact
ctgttttga

DBGET integrated database retrieval system