KEGG   Pan troglodytes (chimpanzee): 100614341Help
Entry
100614341         CDS       T01005                                 

Gene name
USP41
Definition
ubiquitin specific peptidase 41
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100614341 (USP41)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100614341 (USP41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 234 aa AA seqDB search
MDGVLFRAHQRQYVHPCVHVYVTVGLMDPLCIICGFIYIWGHHPQLGASSMSGGIIRSWE
LHPQLVCLICLVGLHNIGQTCCLNSLIQVFVMNVDFARILKRITVPRGADEQRRSVPFQM
LLLLEKMQDSQQKAVWPLELAYCLQKYNVPLIVFLDFSQILPMKRESCDAEEQSGGQYEL
FAVIAHMGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHW
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggatggcgtcttgttcagggctcatcagcgtcagtatgtgcatccttgtgtacatgtg
tatgtcactgtgggcctcatggatcccctgtgcatcatttgtggcttcatctacatctgg
gggcatcatccacagctgggggcttcatccatgtctgggggcatcatccgcagctgggag
cttcatccacagctggtttgcctgatctgcctggttggtttacacaacattggacagacc
tgctgccttaactccttgattcaggtgtttgtaatgaatgtggactttgccaggatattg
aagaggatcacggtgcccaggggagccgacgagcagaggagaagtgtccctttccagatg
cttctgctgctggagaagatgcaggacagccagcagaaagcagtgtggcccctggagctg
gcctactgcctgcagaagtacaacgtgcccctgattgtattcttggatttcagccagatc
cttccaatgaagcgagagtcttgtgatgctgaggagcagtctggagggcagtatgagctt
tttgctgtgattgcgcacatgggaatggcagactctggtcattactgtgtctacatccgg
aatgctgtggatggaaaatggttctgcttcaatgactccaatatttgcttggtgtcctgg
gaagacatccagtgtacctatggaaatcctaactaccactggtaa

DBGET integrated database retrieval system