KEGG   Pan troglodytes (chimpanzee): 100614466Help
Entry
100614466         CDS       T01005                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ptr04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2A
AA seq 391 aa AA seqDB search
MDHQDPYSVQATAAIAXXGYWDFRCTWCEAYLELDVLFCTSSIVHLSAISLDRYWAVSRA
LEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASS
IGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPAL
ASLASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSRQGQKEDVCGASPEDEA
EEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRR
RAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNS
SLNPVIYTIFNQDFRRAFRRILCRPWTQTAW
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggacccctactccgtgcaggccacggcggccatagcgnnnnngggctac
tgggacttccggtgcacgtggtgcgaggcgtacctggagctcgacgtgctcttctgcacc
tcgtccatcgtgcacctgagcgccatcagcctggaccgctactgggccgtgagccgcgcg
ctggagtacaactctaagcgcaccccgcgccgcatcaagtgcatcatcctcactgtgtgg
ctcatcgccgccgtcatctcgctgccgcccctcatctacaagggcgaccagggcccccag
ccgcgcgggcgcccccagtgcaagctcaaccaggaggcctggtacatcctggcctccagc
atcggatctttctttgctccttgcctcatcatgatccttgtctacctgcgcatctacctg
atcgccaaacgcagcaaccgcagaggtcccagggccaagggggggcctgggcagggtgag
tccaagcagccccgacccgaccatggtggggctttggcctcagccaaactgccagccctg
gcctctctggcttctgccagagaggtcaacggacactcgaagtccactggggagaaggag
gagggggagacccctgaagatactgggacccgggccttgccacccagttgggctgccctt
cccaactcacgccagggccagaaggaggatgtttgtggggcatctccagaggatgaagct
gaagaggaggaagaggaggaggaggaagagtgtgaaccccaggcagtgccagtgtctccg
gcctcagcttgcagccccccgctgcagcagccacagggctcccgggtgctggccacccta
cgtggccaggtgctcctgggcaggggcgtgggtgctataggtgggcagtggtggcgtcga
cgggcgcagctgacccgggagaagcgcttcaccttcgtgctggctgtggtcattggcgtt
tttgtgctctgctggttccccttcttcttcagctacagcctgggcgccatctgcccgaag
cactgcaaggtgccccatggcctcttccagttcttcttctggatcggctactgcaacagc
tcactgaaccctgttatctacaccatcttcaaccaggacttccgccgtgccttccggagg
atcctgtgccgcccgtggacccagacggcctggtga

DBGET integrated database retrieval system