KEGG   Pan troglodytes (chimpanzee): 100615987Help
Entry
100615987         CDS       T01005                                 

Definition
trypsin-1-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ptr04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:ptr04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:ptr04974]
Human Diseases; Infectious diseases; Influenza A [PATH:ptr05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAAPFDDDDKIVGGYTCQKNSLPYQVSLNSGYHFCGGSLINEQWVVS
AAHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYNSKTVNNDIMLIKLSTPAVIN
ARVSTISLPTAPPAAGTECLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKNRPGVYTKVYNYVKWIK
DTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagctgctgttgctgccccctttgacgat
gatgacaagatcgttgggggctacacctgtcagaagaattctctcccctaccaggtgtcc
ctgaattctggctaccacttctgcggtggctccctcatcaacgaacagtgggtggtgtca
gcagctcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcataaatgcggccaagatcatccgccacccccaatacaac
agtaagactgtgaacaatgacatcatgctgatcaagctctccacacctgccgtcatcaat
gcccgtgtgtccaccatctctctgcccaccgcccctccagctgctggcaccgagtgcctc
atctccggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggacgctcctgtgctgagccaggctaagtgtgaagcctcctaccccggaaagattacc
agcaacatgttctgtgtgggcttcctcgagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaatggacagctccaaggagttgtctcctggggctatggttgt
gcccagaagaacaggcctggagtctacaccaaggtctacaactatgtgaaatggattaag
gacaccatagctgccaacagctaa

DBGET integrated database retrieval system