KEGG   Pan troglodytes (chimpanzee): 100616521Help
Entry
100616521         CDS       T01005                                 

Definition
cationic trypsin-3-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100616521
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100616521
   04974 Protein digestion and absorption
    100616521
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100616521
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100616521
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100616521
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100616521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 247 aa AA seqDB search
MKTFIFLALLXAAAAFPTSDDDDKIVGGYTCQRNAVPYQXSLNAGYHFCGGSLINNKWEV
SAAHCYKSRIQVRLREYNIKVYEGNEQFINAAKIICHPKYNSATIDNDIMLIKLSSAATI
SSQVATISLPRSCAAAGTQCLISGWGNTLSSGTNYPDLLQCLKAPILSNTACCTAYPGKI
TTNMICLGFLEGXKDSCQGDSGCPVVCNGELQGIVSWGYGCPQKNKPGVYTKVCNHVKWI
QQTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgctctcctgtgagctgctgccgctttccccactagtgat
gatgatgacaagatcgttgggggctacacctgtcagaggaatgctgtcccttatcagngg
tccctgaatgctggctatcacttctgtggtggctccctcatcaataacaaatgggaggtg
tccgcggctcactgctataagtcccgaatccaagtgcgtctcagagaatacaacattaag
gtctatgaaggcaatgaacaattcataaatgcagccaagattatttgccaccccaagtat
aactcagccaccattgataatgacatcatgctgattaagctgagctcagccgccaccatc
agctctcaagtggccaccatctctctgccaagatcctgtgcagcggctggtactcagtgc
ctcatctctggctggggcaacaccctgagcagtggcaccaactaccctgatctcctgcag
tgtctgaaggctcccattctctctaacactgcttgctgcacagcctacccaggcaagatt
actacaaacatgatatgtctgggattcctggagggttgaaaggactcttgccagggtgac
tctggttgtcctgtggtctgcaacggagaactccagggcattgtctcctggggctatggt
tgtcctcagaagaacaaacctggagtctacactaaagtttgcaaccacgtgaaatggatt
cagcagaccattgctgccaactaa

DBGET integrated database retrieval system