KEGG   Pan troglodytes (chimpanzee): 101059399Help
Entry
101059399         CDS       T01005                                 

Definition
(RefSeq) thymosin beta-4
  KO
K05764  
thymosin, beta 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101059399
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     101059399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 73 aa AA seqDB search
YYGDNSVVATAQTRLRSYSRAWLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPS
KETIEQEKQAGES
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
tattatggcgacaactcggtggtggccactgcgcagaccagacttcgctcgtactcgcgc
gcctggctccgcttttcctccgcaaccatgtctgacaaacccgatatggctgagatcgag
aaattcgataagtcgaaactgaagaagacagagacgcaagagaaaaatccactgccttcc
aaagaaacgattgaacaggagaagcaagcaggcgaatcgtaa

DBGET integrated database retrieval system