KEGG   Pan troglodytes (chimpanzee): 101059399Help
Entry
101059399         CDS       T01005                                 

Definition
thymosin beta-4-like
Orthology
K05764  
thymosin, beta 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101059399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system