KEGG   Pan troglodytes (chimpanzee): 449627Help
Entry
449627            CDS       T01005                                 

Gene name
FOXP2
Definition
(RefSeq) forkhead box P2
  KO
K09409  
forkhead box protein P
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    449627 (FOXP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
7
AA seq 716 aa AA seqDB search
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQHPGKQAKEQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQ
GLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSST
TSSTTSKASPPITHHSIVNGQSSVLNARRDSSSHEETGASHTLYGHGVCKWPGCESICED
FGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPS
PKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRH
SDKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFA
YFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIP
TSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSS
PGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaatctgcgacagagacaataagcaacagttcaatgaatcaaaatggaatg
agcactctaagcagccaattagatgctggcagcagagatggaagatcaagtggtgacacc
agctctgaagtaagcacagtagaactgctgcatctgcaacaacagcaggctctccaggcg
gcaagacaacttcttttacagcagcaaacaagtggattgaaatctcctaagagcagtgat
aaacagagaccactgcaggtgcctgtgtcagtggccatgatgactccccaggtgatcacc
cctcagcaaatgcagcagatccttcagcaacaagtcctgtctcctcagcagctccaagcc
cttctccaacaacagcaggctgtcatgctgcagcagcaacaactacaagagttttacaag
aaacagcaagagcagttacatcttcagcttttgcagcagcagcagcaacagcagcagcag
caacaacagcagcaacaacagcagcagcaacaacaacaacagcagcagcagcaacaacag
cagcagcagcagcaacagcagcagcagcagcaacagcatcctggaaagcaagcgaaagag
cagcagcagcagcagcagcagcaacagcaattggcagcccagcagcttgtcttccagcag
cagcttctccagatgcaacaactccagcagcagcagcatctgctcagccttcagcgtcag
ggactcatctccattccacctggccaggcagcacttcctgtccaatcgctgcctcaagct
ggcttaagtcctgctgagattcagcagttatggaaagaagtgactggagttcacagtatg
gaagacaatggcattaaacatggagggctagacctcactactaacaattcctcctcgact
acctcctccaccacttccaaagcgtcaccaccaataactcatcattccatcgtgaatgga
cagtcttcagttctaaatgcaagacgagacagctcgtcacatgaggagactggggcctct
cacactctctatggccatggagtttgcaaatggccaggctgtgaaagcatttgtgaagat
tttggacagtttttaaagcaccttaacaatgaacacgcattggatgaccgaagcactgct
cagtgtcgagtgcaaatgcaggtggtgcaacagttagaaatacagctttctaaagaacgc
gaacgtcttcaagcaatgatgacccacttgcacatgcgaccctcagagcccaaaccatct
cccaaacctctaaatctggtgtctagtgtcaccatgtcgaagaatatgttggagacatcc
ccacagagcttacctcaaacccctaccacaccaacggccccagtcaccccgattacccag
ggaccctcagtaatcaccccagccagtgtgcccaatgtgggagccatacgaaggcgacat
tcagacaaatacaacattcccatgtcatcagaaattgccccaaactatgaattttataaa
aatgcagatgtcagacctccatttacttatgcaactctcataaggcaggctatcatggag
tcatctgacaggcagttaacacttaatgaaatttacagctggtttacacggacatttgct
tacttcaggcgtaatgcagcaacttggaagaatgcagtacgtcataatcttagcctgcac
aagtgttttgttcgagtagaaaatgttaaaggagcagtatggactgtggatgaagtagaa
taccagaagcgaaggtcacaaaagataacaggaagtccaaccttagtaaaaaatatacct
accagtttaggctatggagcagctcttaatgccagtttgcaggctgccttggcagagagc
agtttacctttgctaagtaatcctggactgataaataatgcatccagtggcctactgcag
gccgtccacgaagacctcaatggttctctggatcacatcgacagcaatggaaacagtagt
ccgggctgctcacctcagccgcacatacattcaatccacgtcaaggaagagccagtgatt
gcagaggatgaagactgcccaatgtccttagtgacaacagctaatcacagtccagaatta
gaagacgacagagagattgaagaagagcctttatctgaagatctggaatga

DBGET integrated database retrieval system