KEGG   Pan troglodytes (chimpanzee): 449640Help
Entry
449640            CDS       T01005                                 

Gene name
LILRB5, LIR8
Definition
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5
Orthology
K06512  
leukocyte immunoglobulin-like receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    449640 (LILRB5)
Cellular antigens [BR:ptr04090]
 Proteins
  449640 (LILRB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 643 aa AA seqDB search
MTLTLSVLICLGLNVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRL
DKEGLPWAWERQNPLEPGAKAKFHILSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGF
YAEPTLLALPSPVVASGGNVTLQCDTRDGLLTFVLVEEEQKLPRTLYSQKLPKGPSRALF
PVGPVTPSFRWRFRCYYYYRKNPQVWSHPSDLLEILVPGVSRKPSLLIPQGSVVARGGSL
TLQCRSDVGYDRFVLYKEGGHDLVQGSGQQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
LSPRWSAPSDPLDILIAGLIPDRPSLSVQPGPTVASGENVTLLCQSWRQIDTFFLTKEGA
AHPPLCLKSKYQFYKYQAEFSMSPVTSARGGTYRCYSAIRSYPHLLSSPSYPLELVVSGP
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLR
HRHQSKHRTSAHFYRPAGAAGPEPKDQVLQKRASPVADTQEEILNAAVKDTQPKDGAEMD
ARQSPRDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDTQAEEDRQMDTQAAASE
APQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaccctctcagtcctgatttgcctcgggctgaatgtgggccccaggacctgc
gtgcaggcaggcaccctccccaaacccaccctctgggctgagccagcctctgtgatagcc
cgggggaagcccgtgaccctctggtgtcaggggcccctggagactgaggagtaccgtctg
gataaggagggactcccatgggcctgggagagacagaacccactggagcctggagccaag
gccaagttccacattctatccacggtgtatgacagtgcagggcgataccgctgctactat
gagacccctgcaggctggtcagagcccagtgaccccctggagctggtggcgacaggattc
tatgcagaacccactctcttagccctgccgagtcctgtggtggcctcaggaggaaatgtg
accctccagtgtgatacacgggacggacttctcacgtttgttcttgttgaggaagaacag
aagctccccaggaccctgtactcacagaagctccccaaagggccatcgcgggccctgttc
cctgtgggtcccgtgacccccagcttcaggtggaggttcagatgctattactattacagg
aaaaaccctcaggtgtggtcgcaccccagtgacctcctggagattctggtcccaggcgtg
tctaggaagccctccctcctgatcccgcagggctctgtcgtggcccgcggaggcagcctg
accctgcagtgtcgctctgatgtcggctatgacagatttgttctgtacaaggagggggga
catgacctcgtccagggctctggccagcagccccaggctgggctctcccaggccaacttc
accctgagccctgtgagccgctcctacgggggtcagtacagatgctacggtgcacacaac
ctctcccctaggtggtcggcccccagtgaccccctggacatcctgatcgcaggactgatc
cctgacagaccctccctctcggtgcagccgggccccacggtggcctcaggagagaacgtg
accctgctgtgtcagtcatggcgtcagatagacactttctttttgaccaaggagggggca
gcccatcccccgctgtgtctaaagtcaaagtaccagttttataaataccaggctgaattc
tccatgagtcctgtgacctcagcccggggtggaacctaccgatgctacagcgcaatcagg
tcctacccccacctgctgtccagccctagttaccccctggagctcgtggtctcaggaccc
tctggggatcccagcctctcacctacaggctccacccccacacctggccctgaggaccag
cccctcacccccacggggttggatccccagagtggtctgggaaggcacctgggggttgtg
actggggtctcagtggccttcgtcctgctgctgttcctcctcctcttcctcctcctccga
catcggcatcagagcaaacacaggacatcggcccatttctaccgtcctgcaggggctgcg
gggccagagcccaaggaccaggtcctgcagaagagggccagcccagttgctgacacccag
gaggaaattctcaatgctgctgtgaaggacacacagcccaaggacggggcggagatggac
gctcggcagagcccacgtgatgaagacccccaggcagtgacatatgccgaggtgaaacac
tccagacctaggagagaaatggcctctcctccttccccactgtctggggaattcctggac
acaaaggacacacaggcagaagaggacaggcagatggacactcaggctgctgcatctgaa
gccccccaggatgtgacctacgcccagcttcacagcttgaccctcagacgggaggcaact
gagcctcctccatcccaggaaagggaacctccagctgagcccagcatctacgcccccctg
gccatccactag

DBGET integrated database retrieval system