KEGG   Pan troglodytes (chimpanzee): 449640Help
Entry
449640            CDS       T01005                                 

Gene name
LILRB5
Definition
(RefSeq) leukocyte immunoglobulin-like receptor subfamily B member 5 precursor
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    449640 (LILRB5)
CD molecules [BR:ptr04090]
 Proteins
  449640 (LILRB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 449640
NCBI-ProteinID: NP_001009027
Ensembl: ENSPTRG00000011452
UniProt: Q8MJZ7
Position
19
AA seq 643 aa AA seqDB search
MTLTLSVLICLGLNVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRL
DKEGLPWAWERQNPLEPGAKAKFHILSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGF
YAEPTLLALPSPVVASGGNVTLQCDTRDGLLTFVLVEEEQKLPRTLYSQKLPKGPSRALF
PVGPVTPSFRWRFRCYYYYRKNPQVWSHPSDLLEILVPGVSRKPSLLIPQGSVVARGGSL
TLQCRSDVGYDRFVLYKEGGHDLVQGSGQQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
LSPRWSAPSDPLDILIAGLIPDRPSLSVQPGPTVASGENVTLLCQSWRQIDTFFLTKEGA
AHPPLCLKSKYQFYKYQAEFSMSPVTSARGGTYRCYSAIRSYPHLLSSPSYPLELVVSGP
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLR
HRHQSKHRTSAHFYRPAGAAGPEPKDQVLQKRASPVADTQEEILNAAVKDTQPKDGAEMD
ARQSPRDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDTQAEEDRQMDTQAAASE
APQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaccctctcagtcctgatttgcctcgggctgaatgtgggccccaggacctgc
gtgcaggcaggcaccctccccaaacccaccctctgggctgagccagcctctgtgatagcc
cgggggaagcccgtgaccctctggtgtcaggggcccctggagactgaggagtaccgtctg
gataaggagggactcccatgggcctgggagagacagaacccactggagcctggagccaag
gccaagttccacattctatccacggtgtatgacagtgcagggcgataccgctgctactat
gagacccctgcaggctggtcagagcccagtgaccccctggagctggtggcgacaggattc
tatgcagaacccactctcttagccctgccgagtcctgtggtggcctcaggaggaaatgtg
accctccagtgtgatacacgggacggacttctcacgtttgttcttgttgaggaagaacag
aagctccccaggaccctgtactcacagaagctccccaaagggccatcgcgggccctgttc
cctgtgggtcccgtgacccccagcttcaggtggaggttcagatgctattactattacagg
aaaaaccctcaggtgtggtcgcaccccagtgacctcctggagattctggtcccaggcgtg
tctaggaagccctccctcctgatcccgcagggctctgtcgtggcccgcggaggcagcctg
accctgcagtgtcgctctgatgtcggctatgacagatttgttctgtacaaggagggggga
catgacctcgtccagggctctggccagcagccccaggctgggctctcccaggccaacttc
accctgagccctgtgagccgctcctacgggggtcagtacagatgctacggtgcacacaac
ctctcccctaggtggtcggcccccagtgaccccctggacatcctgatcgcaggactgatc
cctgacagaccctccctctcggtgcagccgggccccacggtggcctcaggagagaacgtg
accctgctgtgtcagtcatggcgtcagatagacactttctttttgaccaaggagggggca
gcccatcccccgctgtgtctaaagtcaaagtaccagttttataaataccaggctgaattc
tccatgagtcctgtgacctcagcccggggtggaacctaccgatgctacagcgcaatcagg
tcctacccccacctgctgtccagccctagttaccccctggagctcgtggtctcaggaccc
tctggggatcccagcctctcacctacaggctccacccccacacctggccctgaggaccag
cccctcacccccacggggttggatccccagagtggtctgggaaggcacctgggggttgtg
actggggtctcagtggccttcgtcctgctgctgttcctcctcctcttcctcctcctccga
catcggcatcagagcaaacacaggacatcggcccatttctaccgtcctgcaggggctgcg
gggccagagcccaaggaccaggtcctgcagaagagggccagcccagttgctgacacccag
gaggaaattctcaatgctgctgtgaaggacacacagcccaaggacggggcggagatggac
gctcggcagagcccacgtgatgaagacccccaggcagtgacatatgccgaggtgaaacac
tccagacctaggagagaaatggcctctcctccttccccactgtctggggaattcctggac
acaaaggacacacaggcagaagaggacaggcagatggacactcaggctgctgcatctgaa
gccccccaggatgtgacctacgcccagcttcacagcttgaccctcagacgggaggcaact
gagcctcctccatcccaggaaagggaacctccagctgagcccagcatctacgcccccctg
gccatccactag

DBGET integrated database retrieval system