KEGG   Pan troglodytes (chimpanzee): 450161Help
Entry
450161            CDS       T01005                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04714  Thermogenesis
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05014  Amyotrophic lateral sclerosis (ALS)
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05140  Leishmaniasis
ptr05142  Chagas disease (American trypanosomiasis)
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05164  Influenza A
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05205  Proteoglycans in cancer
ptr05418  Fluid shear stress and atherosclerosis
Module
ptr_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    450161 (MAPK14)
   04010 MAPK signaling pathway
    450161 (MAPK14)
   04370 VEGF signaling pathway
    450161 (MAPK14)
   04668 TNF signaling pathway
    450161 (MAPK14)
   04068 FoxO signaling pathway
    450161 (MAPK14)
   04071 Sphingolipid signaling pathway
    450161 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    450161 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    450161 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    450161 (MAPK14)
   04620 Toll-like receptor signaling pathway
    450161 (MAPK14)
   04621 NOD-like receptor signaling pathway
    450161 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    450161 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    450161 (MAPK14)
   04660 T cell receptor signaling pathway
    450161 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    450161 (MAPK14)
   04659 Th17 cell differentiation
    450161 (MAPK14)
   04657 IL-17 signaling pathway
    450161 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    450161 (MAPK14)
   04670 Leukocyte transendothelial migration
    450161 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    450161 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    450161 (MAPK14)
   04917 Prolactin signaling pathway
    450161 (MAPK14)
   04926 Relaxin signaling pathway
    450161 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    450161 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    450161 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    450161 (MAPK14)
   04722 Neurotrophin signaling pathway
    450161 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    450161 (MAPK14)
  Development
   04380 Osteoclast differentiation
    450161 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    450161 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    450161 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    450161 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    450161 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    450161 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    450161 (MAPK14)
   05133 Pertussis
    450161 (MAPK14)
   05152 Tuberculosis
    450161 (MAPK14)
   05164 Influenza A
    450161 (MAPK14)
   05160 Hepatitis C
    450161 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    450161 (MAPK14)
   05169 Epstein-Barr virus infection
    450161 (MAPK14)
   05145 Toxoplasmosis
    450161 (MAPK14)
   05140 Leishmaniasis
    450161 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    450161 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    450161 (MAPK14)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     450161 (MAPK14)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   450161 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 450161
NCBI-ProteinID: NP_001009065
Ensembl: ENSPTRG00000018097
UniProt: Q95NE7 K7BNX5
Position
6
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcaaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccaaagatgaactttgcgaatgtatttattggtgccaatccgctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system