KEGG   Pan troglodytes (chimpanzee): 450164Help
Entry
450164            CDS       T01005                                 

Gene name
ABO
Definition
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    450164 (ABO)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     450164 (ABO)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     450164 (ABO)
Glycosyltransferases [BR:ptr01003]
 Glycan extension
  ABO blood group
   450164 (ABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 354 aa AA seqDB search
MAEVLRTLTGKPKCYALLPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
LQHVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
WQDVSMRRMEMISDFCQRRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPSVLRKLRFTAVPKNHQAVRNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggtgctgcggacgctgaccggaaaaccaaaatgctacgcacttctacctatg
atccttttcctaataatgcttgtcttggtcttgtttggttacggggtcctaagccccaga
agtctaatgccaggaagcctggaacgggggttctgcatggctgttagggaacctgaccat
ctgcagcatgtctcgttgccaaggatggtctacccccagccaaaggtgctgacaccgtgt
aggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgggagggcacgttc
aacatcgacatcctcaacgagcagttcaggctccagaacaccaccattgggttaactgtg
tttgccatcaaaaaatacgtggctttcctgaagctgttcctggagacggcggagaagcac
ttcatggtgggccaccgtgtccactactatgtcttcaccgaccagccagccgcagtgccc
cgcgtgacgctggggaccggtcggcagctgtcggtgctggaggtgcgcgcctacaagcgc
tggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgccagcggcgcttc
ctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttccgcgaccacgtg
ggcgtggagatcctgactccgctgttcggcaccctgcaccctggcttctacggaagcagc
cgggaggccttcacctacgagcgccggccccagtcccaggcctacatccccaaggatgag
ggcgatttctactacctgggggggttcttcggagggtcggtgcaagaggtgcagcggctc
accagggcctgccaccaggccatgatggtcgaccaggccaacggcatcgaggccgtgtgg
cacgacgagagccacctgaacaagtacctgctgcgccacaaacccaccaaggtgctctcc
cccgagtacttgtgggaccagcagctgctgggctggccctccgtcctgaggaagctgagg
ttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system