KEGG   Pan troglodytes (chimpanzee): 450172Help
Entry
450172            CDS       T01005                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    450172 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    450172 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    450172 (THBS4)
  Cell communication
   04510 Focal adhesion
    450172 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    450172 (THBS4)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   450172 (THBS4)
  Exosomal proteins of colorectal cancer cells
   450172 (THBS4)
  Exosomal proteins of bladder cancer cells
   450172 (THBS4)
Heparan sulfate/heparin binding proteins [BR:ptr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  450172 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 870 aa AA seqDB search
MGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGSLELYLDCIQVD
SIHNLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPL
AATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTP
STVVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTGNGITCIDVDECK
YHPCYPGVRCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVPN
SICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIEERQGDVTCVCG
VGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDA
DGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGDGRGDACDDDMD
GDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDS
DGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQ
EDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWV
VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSRNPPH
GWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSR
NVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENI
IWSNLKYRCNDTIPEDFQEFQTQNFDRFDN
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgggacgcttaaacaaagccatcctccgttacctgaagaacgatgggaaggtgcatttg
gtggttttcaacaacctgcagctggcagacggaaggcggcacaggatcctcctgaggctg
agcaatttgcagcgaggggccggctccctagagctctacctggactgcatccaggtggat
tccattcacaatctccccagggcctttgctggcccctcccagaaacctgagaccattgaa
ttgaggactttccagaggaagccacaggacttcttggaagagctgaagctggtggtgaga
ggctcactgttccaggtggccagcctgcaagactgcttcctgcagcagagtgagccactg
gctgccacaggcacaggggactttaaccggcagttcttgggtcaaatgacacaattaaac
caactcctgggagaggtgaaggaccttctgagacagcaggttaaggaaacatcatttttg
cgaaacaccatagctgaatgccaggcttgcggtcctctcaagtttcagtctccgacccca
agcacagtggtgcccccggctccccctgcaccgccaacacgcccacctcgtcggtgtgac
tccaacccatgtttccgaggtgtccaatgtaccgacagcagagatggcttccagtgtggg
ccctgccccgagggctacacaggaaacgggatcacctgtattgatgttgatgagtgcaaa
taccatccctgctacccgggcgtgcgctgcataaatttgtctcctggcttcagatgtgac
gcctgcccagtgggcttcacagggcccatggtgcagggtgttgggatcagttttgccaag
tcaaacaagcaggtctgcactgacattgatgagtgtcgaaatggagcgtgcgttcccaac
tcgatctgcgttaatactttgggatcttaccgctgtgggccttgtaagccggggtatact
ggtgatcagataaggggatgcaaagcggaaagaaactgcagaaacccagagctgaaccct
tgcagtgtgaatgcccagtgcattgaagagaggcagggggatgtgacatgtgtgtgtgga
gttggttgggctggagatggctatatctgtggaaaggatgtggacatcgacagttacccc
gacgaagaactgccatgctctgccaggaactgtaaaaaggacaactgcaaatatgtgcca
aattctggccaagaagatgcagacagagatggcattggcgacgcttgtgacgaggatgct
gacggagatgggatcctgaatgagcaggataactgtgtcctgattcacaatgtggaccaa
aggaacagcgataaagatatctttggggatgcctgtgataactgcctgagtgtcttaaat
aacgaccagaaagacacggatggggatggaagaggagatgcctgtgatgatgacatggat
ggagatggaataaaaaacattctggacaactgcccaaaatttcccaatcgtgaccaacgg
gacaaggatggtgatggtgtgggggatgcctgtgacagttgtcctgatgtcagcaaccct
aaccagtctgatgtggataatgatctggttggggactcctgtgacaccaatcaggacagt
gatggagatgggcaccaggacagcacagacaactgccccaccgtcattaacagtgcccag
ctggacaccgataaggatggaattggtgacgagtgtgatgatgatgatgacaatgatggt
atcccagacctggtgccccctggaccagacaactgccggctggtccccaacccagcccag
gaggatagcaacagcgacggagtgggagacatctgtgagtctgactttgaccaggaccag
gtcattgatcggattgacgtctgcccagagaacgcagaggtcaccctgaccgacttcagg
gcttaccagaccgtggtcctggatcctgaaggggatgcccagatcgatcccaactgggtg
gtcctgaaccagggcatggagattgtacagaccatgaacagtgatcctggcctggcagtg
gggtacacagcttttaatggagttgacttcgaagggaccttccatgtgaatacccagaca
gatgatgactatgcaggctttatctttggctaccaagatagctccaggaatccaccacat
ggatggaagcagacagagcagacgtattggcaagccaccccattccgagcagttgcagaa
cctggcattcagctcaaggctgtgaagtctaagacaggtccaggggagcatctccggaac
tccctgtggcacacgggggacaccagtgaccaggtcaggctgctgtggaaggactccagg
aatgtgggctggaaggacaaggtgtcctaccgctggttcctacagcacaggccccaggtg
ggctatatcagggtacgattttatgaaggctctgagttggtggctgactctggagtcacc
atagacaccacaatgcgtggaggccgacttggcgttttctgcttctctcaagaaaacatc
atctggtccaacctcaagtatcgctgcaatgacaccatccctgaggacttccaagagttt
caaacccagaatttcgaccgcttcgataattaa

DBGET integrated database retrieval system