KEGG   Pan troglodytes (chimpanzee): 450190Help
Entry
450190            CDS       T01005                                 

Gene name
LYZ, LZM
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    450190 (LYZ)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     450190 (LYZ)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   450190 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 148 aa AA seqDB search
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattgttctggggcttgtcctcctttctgttaccgtccagggcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttataacacacgagct
acaaactacaatgctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtataa

DBGET integrated database retrieval system