KEGG   Pan troglodytes (chimpanzee): 450194Help
Entry
450194            CDS       T01005                                 

Gene name
FCGR2A, CD32a
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
Osteoclast differentiation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:ptr04145]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ptr04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:ptr04380]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ptr05322]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:ptr05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ptr05152]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:ptr05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 316 aa AA seqDB search
MAMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLT
CRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLS
EWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPNLSIPQANHSH
SGDYHCTGNIGYTLFSSKPVTITVQAPSVGSSSPVGIIVAVVIATAVAAIVAAVVALIYC
RKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDK
NIYLTLPPNDHVNSNN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgctcccccaaaggct
gtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctgaca
tgccggggggctcgcagccctgagagcgactccattcagtggttccacaatgggaatctc
atccccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggggag
tacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctttcc
gaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcgtgctg
aggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatggaaaa
tcccagaaattctcccatttggatcccaacctctccatcccacaagcaaaccacagtcac
agtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcctgtg
accatcactgtccaagcgcccagcgtgggcagctcttcaccagtggggatcattgtggct
gtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctactgc
aggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgagcca
cctggacgtcaaatgattgccatcagaaagagacaacttgaagaaaccaacaatgactat
gaaacagctgacggcggctacatgactctgaaccccagggcacctactgacgatgataaa
aacatctacctgactcttcctcccaacgaccatgtcaacagtaataactaa

DBGET integrated database retrieval system