KEGG   Pan troglodytes (chimpanzee): 450194Help
Entry
450194            CDS       T01005                                 

Gene name
FCGR2A, CD32a
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
Osteoclast differentiation
Platelet activation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    450194 (FCGR2A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    450194 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    450194 (FCGR2A)
  Development
   04380 Osteoclast differentiation
    450194 (FCGR2A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    450194 (FCGR2A)
  Infectious diseases
   05150 Staphylococcus aureus infection
    450194 (FCGR2A)
   05152 Tuberculosis
    450194 (FCGR2A)
   05140 Leishmaniasis
    450194 (FCGR2A)
Cellular antigens [BR:ptr04090]
 Proteins
  450194 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 316 aa AA seqDB search
MAMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLT
CRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLS
EWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPNLSIPQANHSH
SGDYHCTGNIGYTLFSSKPVTITVQAPSVGSSSPVGIIVAVVIATAVAAIVAAVVALIYC
RKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDK
NIYLTLPPNDHVNSNN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgctcccccaaaggct
gtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctgaca
tgccggggggctcgcagccctgagagcgactccattcagtggttccacaatgggaatctc
atccccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggggag
tacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctttcc
gaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcgtgctg
aggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatggaaaa
tcccagaaattctcccatttggatcccaacctctccatcccacaagcaaaccacagtcac
agtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcctgtg
accatcactgtccaagcgcccagcgtgggcagctcttcaccagtggggatcattgtggct
gtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctactgc
aggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgagcca
cctggacgtcaaatgattgccatcagaaagagacaacttgaagaaaccaacaatgactat
gaaacagctgacggcggctacatgactctgaaccccagggcacctactgacgatgataaa
aacatctacctgactcttcctcccaacgaccatgtcaacagtaataactaa

DBGET integrated database retrieval system