KEGG   Pan troglodytes (chimpanzee): 450266Help
Entry
450266            CDS       T01005                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    450266 (PFKP)
   01230 Biosynthesis of amino acids
    450266 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    450266 (PFKP)
   00030 Pentose phosphate pathway
    450266 (PFKP)
   00051 Fructose and mannose metabolism
    450266 (PFKP)
   00052 Galactose metabolism
    450266 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    450266 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    450266 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    450266 (PFKP)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     450266 (PFKP)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     450266 (PFKP)
Messenger RNA biogenesis [BR:ptr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     450266 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 746 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARC
QAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANIFRKEWSGLLEELARNGQIDKEA
VQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATP
DTPACVVSLNGNHAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLA
IKLPDDQIPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQI
KEIGWTDVGGWTGQGGSILGTKRVLPGKYLEEIATQMRTHSINALLIIGGFEAYKSACDM
AEARGRHQELCIPLCVVPATISNNVPGTEISLGSDTGLNAVVETCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWIT
VKLKEARGRGKKFTTDDSVCVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLM
KILAKYKASYDVSDSGQLEHVQPWSV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgctgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtac
ttcatctacgagggctaccagggcatggtggacggaggctcaaacatcgcagaggccgac
tgggagagtgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgc
caggccttccgcacgcgggaaggccgcctgaaggctgcttgcaacctgctgcagcgtggc
atcaccaacctgtgtgtgatcggcggggacgggagcctcaccggggccaacatcttccgg
aaggagtggagtgggctgctggaggagctggccaggaacggccagatcgataaggaggcc
gtgcagaagtatgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttc
tgtggcaccgacatgaccatcggcacggactccgccctgcacaggatcatcgaggtcgtc
gacgccatcatgaccacggcccagagccaccagaggacctttgttctggaggtgatggga
cgacactgtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttc
cttccagaatctccaccagaggaaggctgggaggagcagatgtgtgtcaaactctcggag
aaccgtgcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacc
caaaataaacccatcacctctgagaaaatcaaagagctcgttgtcacgcagctgggctat
gacacacgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcgttcgac
aggatcttggccagccgcatgggagtggaggcggtcatcgccttgctagaggccacccca
gacaccccagcttgcgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatg
gagtgtgtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagat
gcggttcgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgcc
atcaagctgccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaacgtg
ggggcacccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgcc
gacggccacaggatgctcgccatctatgatggctttgacggcttcgccaagggccagatc
aaagaaatcggctggacagatgtcgggggctggaccggccaaggaggctccattcttggg
acaaaacgcgttctcccggggaagtacttggaagagatcgccacacagatgcgcacacac
agcatcaacgcgctgctgatcatcggtggattcgaggcttacaagagtgcgtgcgacatg
gccgaggcacgaggccgccaccaggagctttgcatccccctgtgtgtggtgccggccacg
attagcaacaatgtcccaggcacagaaataagcctgggctccgacactggcctgaatgct
gtcgttgagacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttc
atcatcgagaccatgggcggctactgtggctacctggccaacatgggggggctcgcggcg
ggagctgatgccgcctacattttcgaagagcccttcgacatcagggatctgcagtccaat
gtggagcacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaat
gagagctgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagaaggc
aaaggcgtgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccc
tctccatttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcact
gtgaaactcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgt
gtgctgggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaa
acggattttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatg
aagatcctggccaagtacaaggccagctatgacgtgtcagactcaggccagctggagcac
gtgcagccctggagtgtctga

DBGET integrated database retrieval system