KEGG   Pan troglodytes (chimpanzee): 450323Help
Entry
450323            CDS       T01005                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8 isoform X2
  KO
K06584  integrin alpha 8
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04151  PI3K-Akt signaling pathway
ptr04510  Focal adhesion
ptr04512  ECM-receptor interaction
ptr04514  Cell adhesion molecules (CAMs)
ptr04810  Regulation of actin cytoskeleton
ptr05165  Human papillomavirus infection
ptr05410  Hypertrophic cardiomyopathy (HCM)
ptr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ptr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    450323 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    450323 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    450323 (ITGA8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    450323 (ITGA8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    450323 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    450323 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    450323 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    450323 (ITGA8)
  Infectious diseases
   05165 Human papillomavirus infection
    450323 (ITGA8)
Cell adhesion molecules [BR:ptr04515]
 Integrins
  Integrin alpha subunits
   450323 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Motif
Other DBs
NCBI-GeneID: 450323
NCBI-ProteinID: XP_016818208
Ensembl: ENSPTRG00000002321
Position
10
AA seq 996 aa AA seqDB search
MSPGASRGPRGSQAPLIAPLCCAAAALGMMLWSPACQAFNLDVEKLTVYSGPKGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLDSHQAHRVFPLVIKRQKSHQCQDFTVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVELRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTNPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
TLSLNGQHFEPEQLGLKSSEGLSGAGDAVQMLLQFG
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccggggccagccgcggtccccggggaagccaggcgccgctgatcgcgcccctc
tgctgcgccgcagccgcgctggggatgatgctgtggtcccccgcctgtcaggcgttcaac
ctggacgtggaaaagctcacagtgtacagcggccccaagggcagctacttcggctacgcc
gtggacttccacatacccgacgcccgcacagcgagtgtcttggtgggggcgcccaaagcc
aacaccagccagccggatatcgtggaagggggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacctatcgagttcaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccgacaccagaaaaggacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaatgctgatccggaaggccagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaagggcaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcaggaaactggcaggagaaaagcagacggaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttaccggggattct
cagcaagaattggttgctggaattccaagaggagcacagaattttggatatgtttccatc
attaactctacggatatgacgtttattcagaatttcacgggagaacagatggcatcttat
tttggatataccgttgtcgtatcagatgttaacagtgatggactggatgatgtcctggtt
ggggcacctctcttcatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctctctcctcttcagagacccccagatcctcactggcacc
gagacgtttgggagattcggtagtgctatggcacacttaggagacctgaaccaagatgga
tacaatgacattgccatcggagtgccttttgcaggcaaggatcaaagaggcaaagtgctc
atttataatgggaacaaagatggcttaaacaccaagccttcccaagttctgcagggagtg
tgggcctcacacgctgtcccttccggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattatc
aatcttgaaaataaaacttgccaggttccagactctatgacatctgctgcctgcttttct
ttaagagtatgtgcatctgtcacaggccagagcattgcaaacacaatagtcttgatggca
gaggtgcaattagattccctgaaacagaaaggagctattaaacggacgctcttccttgat
agccatcaggctcatcgcgtcttccctcttgtgataaaaaggcagaaatcccaccagtgc
caggatttcaccgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccacctttaaagaaggcctggaagtgaaa
ccaatattgaactactacagagaaaacattgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcggctagaccagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattacgttggg
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtggtgtgtgaccttgggaaccctatggtgtctggaacaaattattccctg
ggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaacttcgatctc
caaatcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaaatcaac
atcactgctgtagcgcaggtggaattaagaggagtgtcacaccctccgcagattgttctg
cccattcataactgggaaccagaagaggagccccacaaagaggaggaggttggaccattg
gtggaacatatttatgagctgcacaatattggaccaagtaccatcagtgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctatattttccatattcaa
actctgggacctctgcagtgccaaacaaatcctaatatcaatccacaggatataaagcct
gctgcctccccagaggacacccctgagctcagcgcctttttgcgaaactctactattcct
catcttgtcaggaagagggatgtacatgtggtcgaattccacagacagagccctgcaaaa
atactgaactgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgaa
ggaggagaaagcgcagtcctgaaagtcaggtcacgattatgggcccacaccttcctccag
acattatcactaaatgggcaacattttgaaccagaacagttggggctgaagtcatctgaa
ggcttgagtggggctggagatgcagtgcagatgctcttgcagtttgggtaa

DBGET integrated database retrieval system