KEGG   Pan troglodytes (chimpanzee): 450382Help
Entry
450382            CDS       T01005                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 194 aa AA seqDB search
MQDAHLSCLSPTKWSSVSSADSTEKSASGAGTRNRPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgctcacctgagctgcctgtcacccactaagtggagcagtgtttcttccgca
gactcaactgagaagtcagcctctggggcaggcaccaggaatcggccttttcagttctgt
ctccggcaggctttgaggatgaaggctgcgggcattctgaccctcattggctgcctggtc
acaggcgccgagtccaaaatctacactcgctgcaaactggcaaaaatattctcaagggct
ggcctggacaattactggggctttagccttggaaactggatctgcatggcgtattatgag
agcggctacaacaccacggcccagacggtcctggatgacggcagcatcgactacggcatc
ttccagatcaacagctttgcttggtgcagacgcggaaagctgaaggagaacaaccactgc
catgtcgcctgctcagccttgatcactgatgacctcacagatgcaattatctgtgccagg
aaaattgttaaagagacacaaggaatgaactattggcaaggctggaagaaacattgtgag
ggcagagacctgtccgagtggaaaaaaggctgtgaggtttcctaa

DBGET integrated database retrieval system