KEGG   Pan troglodytes (chimpanzee): 450382Help
Entry
450382            CDS       T01005                                 

Gene name
LYZL1
Definition
lysozyme-like protein 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     450382 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 148 aa AA seqDB search
MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTT
AQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKET
QGMNYWQGWKKHCEGRDLSEWKKGCEVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgggcattctgaccctcattggctgcctggtcacaggcgccgagtccaaa
atctacactcgctgcaaactggcaaaaatattctcaagggctggcctggacaattactgg
ggctttagccttggaaactggatctgcatggcgtattatgagagcggctacaacaccacg
gcccagacggtcctggatgacggcagcatcgactacggcatcttccagatcaacagcttt
gcttggtgcagacgcggaaagctgaaggagaacaaccactgccatgtcgcctgctcagcc
ttgatcactgatgacctcacagatgcaattatctgtgccaggaaaattgttaaagagaca
caaggaatgaactattggcaaggctggaagaaacattgtgagggcagagacctgtccgag
tggaaaaaaggctgtgaggtttcctaa

DBGET integrated database retrieval system