KEGG   Pan troglodytes (chimpanzee): 450620Help
Entry
450620            CDS       T01005                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    450620 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    450620 (PLCE1)
   04015 Rap1 signaling pathway
    450620 (PLCE1)
   04020 Calcium signaling pathway
    450620 (PLCE1)
   04070 Phosphatidylinositol signaling system
    450620 (PLCE1)
   04024 cAMP signaling pathway
    450620 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    450620 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    450620 (PLCE1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     450620 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 2301 aa AA seqDB search
MTSEEITASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISRLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELDRPSMGISPLGNQSAIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKTFLSHF
EDFPDNCDDVEEDAFKNKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTA
WSYIDQKRNGALLPCGRVMEPPSTVEIRQDGSQHLSEAQWYPIYNAVRREETENTVGSLL
HFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SSLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRS
LETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSRGSEDSQKAFD
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS
PASSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQN
KLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLG
ISTTKKKKKILMRGESGEVTDDEMAARKAKMHKECRSRSGSDPQDINEQEESEVNAIANP
PNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTI
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLG
IFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFHGFARFLMDKENF
ASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYN
EEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGL
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLN
PATSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLE
RDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMW
NEQFLFRVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISS
LFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQ
LLQQILTNEQDIKPVTTDFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEE
GYVGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTA
QDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQA
QSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESI
QTKEEKPVGGLSSSDTMDYRQ
NT seq 6906 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaataacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcggctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacgaagtggggagacttctcataccatctcacgactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaatagcaagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgttgggagaaaatcatgccagattctgcaaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggccttcctcagaga
cagttttatgaaatgtacaactctgttgctgaggaagacttgtgtttagaaactggaatt
ccttctccactggaaagaaaggtgttccctggaattcaactggaactagacagaccttcc
atgggcattagtcctttaggaaatcagtcagcgatcatagagacaggcagagcacaccct
gacagcagaagggcggtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgattgtggaaattgtgtaccactacct
gggggtgaggagaagcaaaagaaaaactatgtggcatatacctgtaaactgatggaattg
gccaaaaattgtgataataagaatgagcagctgcagtgtgatcattgtgacaccttgaat
gataaatacttttgctttgaaggctcttgcgagaaggttgacatggtatattcaggtgat
agcttttgtaggaaagactttactgacagtcaagctgccaagacctttttgagccatttt
gaggacttccctgataattgtgatgatgtagaagaagatgcttttaaaaacaaaaaggag
cgatccactttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtg
tatactggaacaagagcaattgtgagaactctgccttctggccacattgggctgactgca
tggagttacatagatcagaagagaaatggtgccttactgccttgtgggagagtaatggaa
cccccgtcaacagtggagataaggcaagatgggagccaacatctgtcagaagcccagtgg
tatcctatctacaatgcagtgagaagagaagaaacagaaaatacagttggatctctactc
catttcctcaccaagctcccagcctccgagacagcccatggaaggataagcgttggtcca
tgcttaaagcaatgtgtccgagacactgtatgtgagtatcgcgccaccctccaaaggact
tcaatatcgcagtacatcactggttctcttctagaagcaaccacgtctttgggagcaaga
agtggccttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgccag
ccaggcccctctgtggccaattccaatgccctcccttcaagttcagctgggatcagcaag
gagctgatcgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctgatg
gagcaagagcagactatttaccgcagggtcttgccagtcgactacctttgcttcttaaca
cgggacttgggcactcctgaatgccagagctccttgccctgcctcaaagcatccatctca
gcgtcgattcttaccactcagaatggagagcacaatgcccttgaagatctggtgatgagg
tttaatgaggtgagctcctgggtgacatggctgatcctcacggcaggctccatggaggag
aagcgagaagtcttttcatatttggtgcatgtggccaaatgctgctggaacatgggcaac
tacaacgctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatgtgg
cagttcatggaccagtctgatattgagaccatgaggagcctgaaggatgctatggcccag
catgagtcctcttgtgagtacagaaaggtggtgacacgtgccctgcacatccctggctgt
aaggtggttccattctgtggggtgtttctgaaggagctctgtgaagtgcttgacggcgcc
tccagcctcatgaagctttgcccgcggtacaattcccaagaagaaactttagagtttgta
gcagattacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaagaat
tcggagaaggagtccactgtcaacagcatctttcaggtcatccggagctgcaatcgaagt
ctggagacagacgaggaggacagccccagtgaaggaaacagctccaggaaaagctccttg
aaggataaaagccgatggcagtttataattggagatttgttggattcagacaatgacatc
tttgagcaatccaaagaatacgactctcgtggttcagaggactcacagaaggccttcgac
catgggacggagctcatcccctggtacgtgctgtccatccaagccgatgtgcaccagttc
ctgctgcagggggccacggtcatccactacgaccaggacacacacctctctgcccgctgc
ttcctccagcttcagcccgacaatagcaccttgacctgggtaaagcccacaactgcctcc
ccagccagcagtaaagcaaaacttggtgtacttaataacacagctgagcctggaaaattc
ccactactgggtaatgctggattaagtagcctgacggaaggggtcttggatctttttgca
gtgaaggctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcagaac
aaactgggtagcatgttcctgtcagagactggtgtgacattgctctatgggcttcagacc
acagacaacagattattgcacttcgtggcaccaaagcacacagctaaaatgctcttcagt
ggattattggaactcactagagctgtgagaaagatgaggaaattccctgaccaaagacag
cagtggctgcggaaacagtacgtcagcctttatcaggaggatggacggtatgaaggccca
actttggctcacgctgtggagttgtttggtggcagacggtggagtgctcgaaaccccagc
cccggaacatcagcaaagaatgctgagaagcccaatatgcagagaaacaataccctgggc
ataagcactaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggtaact
gacgatgagatggcagcccgaaaggccaagatgcacaaagagtgtcgaagccggagtggt
tctgatcctcaagacattaatgaacaagaagaatcagaggtgaatgccatcgctaaccct
ccaaaccccctcccttccagaagagcccactctttgaccacagctgggtcccccaacttg
gctgccgggacgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaac
aagagcccatccagtgcttggagcagtagtagctggcacgggcggatcaaaggcggcatg
aagggatttcagagcttcatggtttcagatagcaacatgagttttgttgaatttgttgag
ctgttcaaatcgttcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtctat
gcagtgccctgcaaccgatctggctctgagtcagccccactctacaccaacctgacaatt
gatgaaaacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctcggat
ttggggttgttcattaagagtaaacagcagctatcggacaaccagaggcagatatctgat
gccattgctgctgcaagcattgtgacaaatggcactgggattgagagcacatctctgggc
atttttggggtgggcatacttcagctcaacgatttcctcgtgaattgccaaggagaacac
tgcacttatgatgaaatcctcagcatcatccagaagtttgagcctagcatcagtatgtgt
catcagggactaatgtcatttcatgggtttgccaggtttctgatggataaagaaaatttt
gcctcaaaaaatgatgagtcacaggagaacattaaagaactgcagctacccctctcatac
tattacatcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggagaatcc
tcggtagaactctacagccaggtccttttgcaaggctgtcgaagtgtagaattggactgc
tgggacggagacgatgggatgcccatcatttatcatggacatacgctgacaaccaagatc
cccttcaaggaagtggtcgaagccattgatcgcagtgccttcatcaactctgacctgcca
atcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaatt
ttcaagactgtgtttggagaaaagctggtgactaaattcttatttgagactgatttttca
gatgatccaatgcttccttcacctgaccaactcagaaagaaagttcttcttaaaaacaag
aagctaaaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagttagca
tctatgcaagcgcaggcttataatggtgggaatgccaaccccccacctgccaataatgag
gaagaggaagatgaggaggacgaatatgattatgactatgaatccctttctgatgacaac
attctggaagacagacctgaaaataaatcatgtaatgacaagcttcagtttgaatataat
gaagaaatcccaaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtt
tatgatatggaactgggagaagaattttatcttgatcagaataaaaaggaaagcagacag
attgcaccagagctttctgaccttgtaatctattgtcaagcagtaaaatttccaggactg
tcaactctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatt
tttggcaacaatccgggcagaatgagcccaggggagacagcatcatttaacaaaacatct
ggaaaaagttcctgtgaaggcattcgacagacctgggaggaatcttcttcccctctcaac
ccagccacgtccctcagtgctatcattagaactcccaaatgttatcatatctcgtcgctg
aatgaaaatgccgccaaacgtctgtgtcgcaggtattctcagaaactgatccagcacacc
gcctgtcagctgctgagaacttaccctgctgccacccgcattgactcttccaacccgaac
cccctcatgttctggctccatgggatacagctcgtggcactcaactaccagaccgatgat
ctccctttacatttaaatgctgcaatgtttgaggcaaatggtggttgtggttatgttttg
aaacctccagttctgtgggacaagaactgccccatgtatcagaagttttctccactagaa
agagatctggacagcatggatcctgcagtctattctttaactattgtctctggtcagaat
gtgtgccccagtaatagcatgggaagcccgtgcattgaagtcgacgtcctgggcatgcct
ctggacagctgccatttccgcacaaagcccatccatcgaaacaccctgaaccccatgtgg
aacgagcagtttctgttccgcgttcacttcgaagatcttgtatttcttcgttttgcagtt
gtggaaaacaatagttcagcggtaactgctcagagaatcattccactgaaagctttaaaa
cgaggatatcgacatcttcagctgcgaaaccttcacaatgaagtcttggagatttctagt
ttattcattaacagcagaaggatggaagaaaattcctctggcaataccatgtcagcctct
tcgatgtttaatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcatggg
gtcccagggccagagccctttaccgttttcactattaatggaggcaccaaggcaaagcag
cttctgcagcaaattctgacaaatgaacaagacatcaaacctgttaccacagactttttg
atggaagaaaaatattttatatctaaagaaaagaatgaatgtaggaaacaaccattccag
agagccattggtccagaagaggagatcatgcaaattttaagcagctggtttccagaagag
ggatacgtgggcaggattgtcttaaaaacccagcaggaaaacctagaagagaaaaacatt
gttcaagatgacaaagaggtgatcttgagctcagaggaggagagtttctttgtccaagtg
catgatgtttctccagagcaacctcgaacagtcatcaaagcaccccgcgtcagcactgca
caggatgtcattcagcagaccttatgcaaagccaaatattcctacagcatcctgagcaac
cccaatccaagcgactatgtgcttttggaagaggtggtgaaagacactaccaacaagaag
accaccacaccaaagtcctctcagcgggtccttctggatcaggagtgtgtgtttcaagcc
caaagcaagtggaaaggtgcaggaaaattcatccttaagctaaaggagcaggtgcaggca
tctcgagaagataaaaagaaaggcatttctttcgcaagtgaactcaagaagctcaccaag
tcaactaaacagccccgaggacttacatcaccttctcagctcttgacctcagaaagtatc
caaaccaaggaggagaaacctgtgggtggcttgtcctccagtgacacaatggattaccga
cagtga

DBGET integrated database retrieval system