KEGG   Pan troglodytes (chimpanzee): 450629Help
Entry
450629            CDS       T01005                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ptr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ptr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 782 aa AA seqDB search
MLSQVYRCGFQPFNQHLLPWVKCTTVFRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
VCGMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSRVGMGGMEAKVK
AALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSG
GRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKL
NSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAAL
AIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLCRLDKMID
LIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACN
ALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLEL
CIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVDSACVFWNASTRFSDGYRF
GLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN
TN
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtttaccgctgtgggttccagcccttcaaccaacatcttctgccctgg
gtcaagtgtacaaccgtcttcagatctcattgtatccagccttcagtcatcagacatgtt
cgttcttggagcaacatcccgtttatcactgtacccctcagtcgtacacatggcaagtcc
ttcgcccaccgcagtgagctgaagcatgccaagagaatcgtggtgaagctcggcagtgcc
gtggtgacccgaggggatgaatgtggcctggccctggggcgcttggcatctattgttgag
caggtatcagtgctgcagaatcagggcagagagatgatgctggtgaccagtggagccgta
gcctttggcaaacaacgcttgcgccatgagatccttctgtctcagagcgtgcggcaggcc
ctccactcggggcagaaccagctgaaagaaatggcaattccagtcttggaggcacgagcc
tgtgcagctgccggacagagtgggctgatggccttgtatgaggctatgtttacccagtac
agcatctgtgctgcccagattttggtgaccaatttggatttccatgatgagcagaagcgc
cggaacctcaatggaacacttcatgaactccttagaatgaacattgtccccattgtcaac
acaaatgatgctgttgtccccccagctgagcccaacagtgacctgcagggggtaaatgtg
gtctgtggaatgaaaactgatctcttgattgttctttcagatgtagaaggcctttttgac
agccccccaggttcagatgatgcaaagcttattgatatattttatcccggagatcagcag
tctgtgacatttggaaccaagtctagagtgggaatgggtggcatggaagccaaggtgaaa
gcagccctctgggctttgcaaggtggcacttctgttgttattgccaatggaacccaccca
aaggtgtctgggcacgtcatcacagacattgtggaggggaagaaagttggtaccttcttt
tcagaagtaaagcctgcaggccctactgttgagcagcagggagaaatggctcgatctgga
ggaaggatgttggccaccttggaacctgagcagagagcagaaattatccatcatctggct
gatctgttgacggaccagcgtgatgagatcctgttagccaacaaaaaagacttggaggag
gcagaggggagacttgcagctcctctgctgaaacgtttaagcctctccacatccaaattg
aacagcctggccattggtctgcgacagatcgcagcctcctcccaggacagcgtgggacgt
gttttgcgccgcacccgaatcgccaaaaacttggaactggaacaagtgactgtcccaatt
ggagttctgctggtgatctttgaatctcgtcctgactgtctaccccaggtggcagctttg
gctatcgcaagtggtaatggcttgttactcaaaggaggaaaggaggctgcacacagcaac
cggattctccacctcctgacccaggaggctctctcaatccatggagtcaaggaggccgtg
caactggtgaataccagagaagaagttgaagatctttgccgcctagacaaaatgatagat
ctgatcattccacgtggctcttcccagctggtcagagacatccagaaagctgctaagggg
attccagtgatggggcacagcgaagggatctgtcacatgtatgtggattccgaggccagt
gttgataaggtcaccaggctagtcagagactctaaatgtgaatatccagctgcctgtaat
gctttggagactttgttaatccaccgggatctgctcaggacaccattatttgaccagatc
attgatatgctgagagtggaacaggtaaaaattcatgcaggccccaaatttgcctcctat
ctgaccttcagcccctccgaagtgaagtcactccgaactgagtatggggacctggaatta
tgcattgaagtagtggacaacgttcaggatgccattgaccacatccacaagtatggcagc
tcccacacggatgtcatcgtcacagaggatgaaaacacagcggagttcttcctgcagcac
gtagacagtgcctgtgtgttctggaatgccagcactcgcttttctgatggttaccgcttt
ggactgggagctgaagtgggaatcagtacatcgagaatccacgcccggggaccagtagga
cttgagggactgcttactactaagtggctgctgcgagggaaggaccacgtggtctcagat
ttctcagagcatggaagtttaaaatatcttcatgagaacctccctattcctcagagaaac
accaactga

DBGET integrated database retrieval system