KEGG   Pan troglodytes (chimpanzee): 450676Help
Entry
450676            CDS       T01005                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    450676 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    450676 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    450676 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    450676 (SCD)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     450676 (SCD)
Lipid biosynthesis proteins [BR:ptr01004]
 Desaturase
  First
   450676 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 359 aa AA seqDB search
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETTPLYLEDNIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKTGLLLMCFILPTLVPWYFWGE
TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggacgatatctctagctcctataccaccaccaccaccatt
acagcgcctccctccagggtcctgcagaatggaggagataagttggagacgacgcccctc
tacttggaagacaacattcgccctgatataaaagatgatatatatgaccccacctacaag
gataaggaaggcccaagccccaaggttgaatatgtctggagaaacatcatccttatgtct
ctgctacacttgggagccctgtatgggatcactttgattcctacctgcaagttctacacc
tggctttggggggtattctactattttgtcagtgccctgggcataacagcaggagctcat
cgtctgtggagccaccgctcttacaaagctcggctgcccctacggctctttctgatcatt
gccaacacaatggcattccagaatgatgtctatgaatgggctcgtgaccaccgtgcccac
cacaagttttcagaaacacatgctgatcctcataattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagagaagggcagtacgcta
gacttgtctgacctagaagctgagaaactggtgatgttccagaggaggtactacaaaact
ggcttgctgctgatgtgcttcatcctgcccacgcttgtgccctggtatttctggggtgaa
acttttcaaaacagtgtgttcgttgccactttcttgcgatatgctgtggtgcttaatgcc
acctggctggtgaacagtgctgcccacctcttcggatatcgtccttatgacaagaacatt
agcccccgggagaatatcctggtttcacttggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttcacc
acattcttcattgattgcatggccgccctcggtctggcctatgaccggaagaaagtctcc
aaggccgccatcttggccaggattaaaagaaccggagacggaaactacaagagtggctga

DBGET integrated database retrieval system