KEGG   Pan troglodytes (chimpanzee): 450857Help
Entry
450857            CDS       T01005                                 

Gene name
CYP2E1
Definition
(RefSeq) cytochrome P450 2E1 isoform X1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00140  Steroid hormone biosynthesis
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    450857 (CYP2E1)
   00590 Arachidonic acid metabolism
    450857 (CYP2E1)
   00591 Linoleic acid metabolism
    450857 (CYP2E1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    450857 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    450857 (CYP2E1)
   00983 Drug metabolism - other enzymes
    450857 (CYP2E1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    450857 (CYP2E1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    450857 (CYP2E1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     450857 (CYP2E1)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   450857 (CYP2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 450857
NCBI-ProteinID: XP_016775177
Ensembl: ENSPTRG00000003099
UniProt: A0A2I3RY31
Position
10
AA seq 493 aa AA seqDB search
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKEGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYDDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSVLHYLPGSHRKVIKNVA
EIKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEVQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccctcggagtcaccgtggccctgctggtgtgggcggccttcctcctgctggtg
tccatgtggaggcaggtgcacagcagctggaatctgcccccaggccctttcccgcttccc
atcatcgggaacctcttccagttggaattgaagaatattcccaagtccttcacccggctg
gcccagcgcttcgggccggtgttcacgctgtacgtgggctcgcagcgcatggtggtgatg
cacggctacaaggcggtgaaggaagcgctgctggactacaaggacgagttctcgggcaga
ggcgacctccccgcgttccatgcgcacagggacaggggaatcatttttaataatggacct
acctggaaggacatccggcggttttccctgaccaccctccggaactatgggatggggaaa
gagggcaatgagagccggatccagagggaggcccacttcctgctggaagcgctcaggaag
acccaaggccagcctttcgaccccaccttcctcatcggctgcgcgccctgcaacgtcata
gccgacatcctgttccgcaagcattttgactacgatgatgagaagtttctaaggctgatg
tatttgtttaatgagaacttccacctactcagcactccctggctccagctttacaataat
tttcccagcgttctacactacttgcctggaagccatagaaaagtcataaaaaatgtggct
gaaataaaagagtatgtgtctgaaagggtgaaggagcaccatcaatctctggaccccaac
tgtccccgggacctcaccgactgcctgctcgtggaaatggagaaggaaaagcacagcgca
gagcgcttgtacacaatggacggtatcaccgtgactgtggccgacctgttctttgcgggg
acagagaccaccagcacaactctgagatatgggctcctgattctcatgaaataccctgag
atcgaagagaagctccatgaagaaattgacagggtgattgggccaagccgaatccctgcc
atcaaggataggcaagagatgccctacatggatgctgtggtgcatgaggttcagcggttc
atcaccctcgtgccctccaacctgccccatgaagcaacccgagacaccattttcagagga
tacctcatccccaagggcacagtcgtagtgccaactctggactctgttttgtatgacaac
caagaatttcctgatccagaaaagtttaagccagaacacttcctgaatgaaaatggaaag
ttcaagtacagtgactatttcaagccattttccacaggaaaacgagtgtgtgctggagaa
ggcctggctcgcatggagttgtttcttttgttgtgtgccattttgcagcattttaatttg
aagcctctcgttgacccaaaggatatcgacctcagccctatacatattgggtttggctgt
atcccaccacgttacaaactctgtgtcattccccgctcatga

DBGET integrated database retrieval system