KEGG   Pan troglodytes (chimpanzee): 450857Help
Entry
450857            CDS       T01005                                 

Definition
cytochrome P450 2E1-like
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    450857
   00590 Arachidonic acid metabolism
    450857
   00591 Linoleic acid metabolism
    450857
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    450857
   00982 Drug metabolism - cytochrome P450
    450857
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    450857
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    450857
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     450857
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   450857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 468 aa AA seqDB search
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKEGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYDDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSVLHYLPGSHRKVIKNVA
EIKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEAYMDAVVHDVQRFITLVPSNLPLEATRDTIFRGYLIPK
GTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARM
ELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccctcggagtcaccgtggccctgctggtgtgggcggccttcctcctgctggtg
tccatgtggaggcaggtgcacagcagctggaatctgcccccaggccctttcccgcttccc
atcatcgggaacctcttccagttggaattgaagaatattcccaagtccttcacccggctg
gcccagcgcttcgggccggtgttcacgctgtacgtgggctcgcagcgcatggtggtgatg
cacggctacaaggcggtgaaggaagcgctgctggactacaaggacgagttctcgggcaga
ggcgacctccccgcgttccatgcgcacagggacaggggaatcatttttaataatggacct
acctggaaggacatccggcggttttccctgaccaccctccggaactatgggatggggaaa
gagggcaatgagagccggatccagagggaggcccacttcctgctggaagcgctcaggaag
acccaaggccagcctttcgaccccaccttcctcatcggctgcgcgccctgcaacgtcata
gccgacatcctgttccgcaagcattttgactacgatgatgagaagtttctaaggctgatg
tatttgtttaatgagaacttccacctactcagcactccctggctccagctttacaataat
tttcccagcgttctacactacttgcctggaagccatagaaaagtcataaaaaatgtggct
gaaataaaagagtatgtgtctgaaagggtgaaggagcaccatcaatctctggaccccaac
tgtccccgggacctcaccgactgcctgctcgtggaaatggagaaggaaaagcacagcgca
gagcgcttgtacacaatggacggtatcaccgtgactgtggccgacctgttctttgcgggg
acagagaccaccagcacaactctgagatatgggctcctgattctcatgaaataccctgag
atcgaagcctacatggatgctgtggtgcatgatgttcagcggttcatcaccctcgtgccc
tccaacctgccccttgaagcaacccgagacaccattttcagaggatacctcatccccaag
ggcacagtcgtagtgccaactctggactctgttttgtatgacaaccaagaatttcctgat
ccagaaaagtttaagccagaacacttcctgaatgaaaatggaaagttcaagtacagtgac
tatttcaagccattttccacaggaaaacgagtgtgtgctggagaaggcctggctcgcatg
gagttgtttcttttgttgtgtgccattttgcagcattttaatttgaagcctctcgttgac
ccaaaggatatcgacctcagccctatacatattgggtttggctgtatcccaccacgttac
aaactctgtgtcattccccgctcatga

DBGET integrated database retrieval system