KEGG   Pan troglodytes (chimpanzee): 450909Help
Entry
450909            CDS       T01005                                 

Gene name
CYP2C8
Definition
(RefSeq) cytochrome P450 2C8
  KO
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    450909 (CYP2C8)
   00591 Linoleic acid metabolism
    450909 (CYP2C8)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    450909 (CYP2C8)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    450909 (CYP2C8)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    450909 (CYP2C8)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    450909 (CYP2C8)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     450909 (CYP2C8)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   450909 (CYP2C8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSSGRRKLPPGPTPLPIIGNMLQIDVKDICKSFSNFSKV
YGPVFTVYFGMNPIVVLHGYEAVKEALIDNGEEFSGRGSSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLTNVALT
QSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLMHPEVTAKVQEEIDHVIGRHRTPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMTLLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctgtgtctctcttttatgcttctcttttcactctgg
agacagagctctgggagaaggaagctccctcctggccccactcctcttcctattattgga
aatatgctacagatagatgttaaggacatctgcaaatctttcagcaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatagtggtgttgcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcagttcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaagagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcactgccttgtggaggagttaagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgcgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
ttcaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaagtgcttacaaatgttgctcttaca
caaagttacattagggagaaagtaaaagaacaccaagcatcactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgatgcacccggaggtcaca
gctaaagtccaggaagagattgatcatgtaattggcagacacaggaccccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacagtgac
cttgtccccaccggtgtgccccatgcagtgaccactgatactaagttcagaaactacctc
atccccaagggcacaaccataatgacattactgacttccgtgctacacgatgacaaagaa
tttcctaatccaaatatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcgtaccagatctgcttcatccctgtctga

DBGET integrated database retrieval system