KEGG   Pan troglodytes (chimpanzee): 450970Help
Entry
450970            CDS       T01005                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     450970 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 291 aa AA seqDB search
MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAH
HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGNLRFEPKRLGDSVRLGQ
FASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMKKRRLQQP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcggctttgatgatcgccctcggcagcctcggcctccacacctggcaggcc
caggctgttcccatcctgcccctgggcctggctccagacacctttgacgatacctatgtg
ggttgtgcagaggagatggaggagaaggcagcccccctgctaaaggaggaaatggcccac
catgccctgctgcgggaatcctgggaggcagcccaggagacctgggaggacaagcgtcga
gggcttaccttgccccctggcttcaaagcccagaatggaatagccattatggtctacacc
aactcatcgaacaccttgtactgggagttgaatcaggccgtgcggacgggcggaggctcc
cgggagctctacatgaggcactttcccttcaaggccctgcatttctacctgatccgggcc
ctgcagctgctgcgaggcagtgggggttgcagcaggggacctggggaggtggtgttccga
ggtgtgggcaaccttcgctttgaacccaagaggctgggggactctgtccgcttgggccag
tttgcctccagctccctggataaggcagtggcccacagatttggtaatgccaccctcttc
tctctaacaacttgctttggggcccctatacaggccttctctgtctttcccaaggagcgc
gaggtgctgattcccccccatgaagtctttttggttaccagattctctcaggatggagcc
cagagcttggtgactctctggagctataatcagacctgtagccattttaactgcgcctat
ctgggtggggagaagaggcggggctgtgtgtctgcgccaggagccctgggaacgggtgac
cttcatatgaagaagaggcgcctccagcagccttga

DBGET integrated database retrieval system