KEGG   Pan troglodytes (chimpanzee): 451029Help
Entry
451029            CDS       T01005                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 1287 aa AA seqDB search
MVPGEENQLVPKEAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLEDSSAGEDS
VHDRFIGPLPREGSVGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFM
TPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAW
QQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIP
LVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTL
QLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSD
QMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHYYACI
KSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLKDPAR
NAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEV
HKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVK
STYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQL
ISKAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETLDYQMAFAE
SHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERVKGPVGSLKS
VEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSASVDNRELEQ
HIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSH
SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEG
YKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDN
KITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCG
LELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVL
SRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDI
HQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGH
RVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaagaggcaccactggatcataccagc
gacaagtcacttctcgacgctaattttgagccaggaaaaaagaactttctgcatttgaca
gataaagatggtgaacaacctcaaatactgctggaggattccagtgctggggaagacagt
gttcatgacaggtttataggtccgcttccaagagaaggttctgtgggttctaccagtgat
tatgtcagccaaagctactcctactcatctattttgaataaatcagaaactggatatgtg
ggactagtaaaccaagcaatgacttgctatttgaatagccttttgcaaacactttttatg
actcctgaatttaggaatgcattatataagtgggaatttgaagaatctgaagaagatcca
gtgacaagtattccataccaacttcaaaggctttttgttttgttacaaaccagcaaaaag
agagcaattgaaaccacagatgttacaaggagctttggatgggatagtagtgaggcttgg
cagcagcatgatgtacaagaactatgcagagtcatgtttgatgctttggaacagaaatgg
aagcaaacagaacaggctgatcttataaatgagctatatcaaggcaagctgaaggactac
gtgagatgtctggaatgtggttatgagggctggcgaatcgacacatatcttgatattccg
ttggtcatccgaccttatgggtccagccaagcatttgctagtgtggaagaagcattgcat
gcatttattcagccagagattctggatggcccaaatcagtatttttgtgaacgttgtaag
aagaagtgtgatgcacggaagggccttcggtttttgcattttccttatctgctgacctta
cagctgaaaagattcgattttgattatacaaccatgcataggattaaactgaatgatcga
atgacatttcccgaggaactagatatgagtacctttattgatgttgaagatgagaaatct
cctcagactgaaagttgcactgacagtggagcagaaaatgaaggtagttgtcacagtgat
cagatgagcaacgatttctccaatgatgatggtgttgatgaaggaatctgtcttgaaacc
aatagtggaactgaaaagatctcaaaatctggacttgaaaagaattccttgatctatgaa
cttttctctgttatggttcattctgggagcgctgctggtggtcattattatgcatgtata
aagtcattcagtgatgagcagtggtacagcttcaatgatcaacatgtcagcaggataaca
caagaggacattaagaaaacacatggtggatcttcaggaagcagaggatattattctagt
gctttcgcaagttccacaaatgcatatatgctgatctatagactgaaggatccagccaga
aatgcaaaatttctagaagtggatgaatacccagaacatattaaaaacttggtgcagaaa
gagagagagttggaagaacaagaaaagagacaacgagaaattgagcgcaatacatgcaag
ataaaattattctgtttgcatcctacaaaacaagtaatgatggaaaataaattggaggtt
cataaggataagacattaaaggaagcagtagaaatggcttataagatgatggatttagaa
gaggtaatacccctggattgctgtcgccttgttaaatatgatgagtttcatgattatcta
gaacggtcatatgaaggagaagaagatacaccaatggggcttctactaggtggcgtcaag
tcaacatatatgtttgatctgctgttggagacgagaaagcctgatcaggttttccaatct
tataaacctggagaagtgatggtgaaagttcatgttgttgatctaaaggcagaatctgta
gctgctcctataactgttcgtgcttacttaaatcagacagttacagaattcaaacaactg
atttcaaaggccatccatttacctgctgaaacaatgagaatagtgctggaacgctgctac
aatgatttgcgtcttctcagtgtctccagtaaaaccctgaaagctgaaggattttttaga
agtaacaaggtgtttgttgaaagctccgagactttggattaccagatggcctttgcagag
tctcatttatggaaactcctggatcggcatgcaaatacaatcagattgtttgttttgcta
cctgaacaatccccaggatcttattccaaaaggacagcataccagaaagctggaggcgat
tctggtaatgtggatgatgactgtgaaagagtcaaaggacctgtaggaagcctaaagtct
gtggaagctattctagaagaaagcactgaaaaactcaaaagcttgtcactgcagcaacag
caggatggagataatggggacagcagcaaaagtactgagacaagtgactttgaaaacatc
gaatcacctctcaatgagagggactcttcagcatcagtggataatagagaacttgaacag
catattcagacttctgatccagaaaattttcagtctgaagaacgatcagactcagatgtg
aataatgacaggagtacaagttcagtggacagtgatattcttagctccagtcatagcagt
gatactttgtgcaatgcagacaatgctcagatccctttggctaatggacttgactctcac
agtatcacaagtagtagaagaacgaaagcaaatgaagggaaaaaagaaacatgggataca
gcagaagaagactctggaactgatagtgaatatgatgagagtggcaagagtaggggagaa
atgcagtacatgtatttcaaagctgaaccttatgctgcagatgaaggttctggggaagga
tataaatggttgatggtgcatgttgataaaagaattactctggcagctttcaaacaacat
ttagagccctttgttggagttttgtcctctcacttcaaggtctttcgagtgtatgccagc
aatcaagagtttgagagcgtccggctgaatgagacactttcatcattttctgatgacaat
aagattacaattagactggggagagcacttaaaaaaggagaatacagagttaaagtatac
cagcttttggtcaatgaacaagagccatgcaagtttctgctagatgctgtgtttgctaaa
ggaatgactgtacggcaatcaaaagaggaattaattcctcagctcagggagcaatgtggt
ttagagctcagtattgacaggtttcgtctaaggaaaaaaacatggaagaatcctggcact
gtctttttggattatcatatttatgaagaagatattaatatttccagcaactgggaggtt
ttccttgaagttcttgatggggtagagaagatgaagtccatgtcacagcttgcagttttg
tcaagacggtggaagccttcagagatgaagttggatcccttccaggaggttgtattggaa
agcagtagtgtggacgaattgcgagagaagcttagtgaaatcagtgggattcctttggat
gatattgaatttgctaagggtagaggaacatttccctgtgatatttctgtccttgatatt
catcaagatttagactggaatcctaaagtttctaccctgaatgtctggcctctttatatc
tgtgatgatggtgcggtcatattttatagggataaaacagaagaattaatggaattgaca
gatgagcaaagaaatgaactgatgaaaaaagaaagcagtcgactccagaagactggacat
cgtgtaacatactcacctcgtaaagagaaagcactaaaaatatatctggatggagcacca
aataaagatctcactcaagactga

DBGET integrated database retrieval system