KEGG   Pan troglodytes (chimpanzee): 451317Help
Entry
451317            CDS       T01005                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04217  Necroptosis
ptr04218  Cellular senescence
ptr05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    451317 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    451317 (CAPN1)
   04217 Necroptosis
    451317 (CAPN1)
   04218 Cellular senescence
    451317 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    451317 (CAPN1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     451317 (CAPN1)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C2: calpain family
   451317 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 451317
NCBI-ProteinID: XP_016776710
Ensembl: ENSPTRG00000003869
UniProt: K7CEN7
Position
11
AA seq 714 aa AA seqDB search
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcacgccggtgtactgcaccggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtgccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggagctgctgtcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacaccctcctgcaccgagtggttccccacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtcgatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gtcaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcaccttcaagaagttggtgaagggccacgcctactctgtgaccggggccaag
caggtgaactaccgaggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctacgggtcaagatggaggacggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccggacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgcttcggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcacgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
ttcgagcccaacaaggagggcgacttcgtgctgcgcttcttctcagagaagagtgctggg
actgcggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcggtcgactttgacaatttcgtttgctgcctggtg
cggctagagaccatgttccgatttttcaaaactctggacacagatctggatggagttgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system