KEGG   Pan troglodytes (chimpanzee): 451329Help
Entry
451329            CDS       T01005                                 

Gene name
KAT5, HTATIP
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    451329 (KAT5)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     451329 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcac
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccaccaag
aacggacttcctgggtcccgtcccggctctccagagagagaggtgccggcctcggcgcag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagacagccccggcctcggtttttccccagaatggagcagcccgtagggcagtg
gcagcccagccaggacggaagcgaaaatcgaattgtttgggcactgatgaggactcccag
gacagctctgatggaataccatcagcaccacgcatgactggcagcctggtgtctgatcga
agccacgacgacatcgtcacccggatgaagaacattgagtgcattgagctgggccggcac
cgcctcaagccgtggtacttctccccgtacccacaggaactcaccacattgcctgtcctc
tacctgtgcgagttctgcctcaagtacggccgtagtctcaagtgtcttcagcgtcatttg
accaagtgtgacctacgacatcctccaggcaatgagatttaccgcaagggcaccatttcc
ttctttgagattgatggacgtaagaacaagagttattcccagaacctgtgtcttttggcc
aagtgtttccttgaccataagacactgtactatgacacagaccctttcctcttctacgtc
atgacagagtatgactgtaagggcttccacatcgtgggctacttctccaaggagaaagaa
tcgacggaagactacaatgtggcctgcatcctaaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcagaccttggcctcctatcctatcgaagctactggtcccag
accatcctggagatcctgatggggctgaagtcggagagcggggagaggccacagatcacc
atcaatgagattagtgaaatcaccagcatcaagaaggaggatgtcatctccactctgcag
tacctcaatctcatcaactactacaagggccagtacatcctcacactgtcagaggacatc
gtggatggccatgagcgggccatgctcaagcggctcctgcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagagggggaagtggtga

DBGET integrated database retrieval system