KEGG   Pan troglodytes (chimpanzee): 451376Help
Entry
451376            CDS       T01005                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ptr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 455 aa AA seqDB search
MKTKFCTGGEAEPSPLGLLLSCGSGSAASAPGVGQQRDAASDLESKQLGGQQPPLALPPP
PPLPLPLPQSPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSN
MLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESV
MFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPF
NKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVF
CHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFF
RASIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGL
WSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattctgcaccgggggcgaggcggagccctcgccgctcgggctgctgctg
agctgcggtagcggcagcgcggcctcggcgcccggcgtggggcagcagcgcgacgccgcc
agcgacctcgagtccaagcagctgggcggccaacagccgccgctcgcgctgccccctccg
ccgccgctgccgctgccgctgccccagtccccgccgccgcagccgcccgcagatgagcag
ccggagccccggacgcggcgcagggcctatctgtggtgcaaggagttcctgcccggcgcc
tggcggggcctccgcgaggacgagttccacatcagtgtcatcagaggcggccttagcaac
atgctgttccagtgctccctacctgacaccacagccacccttggcgatgagcctcggaaa
gtgctcctgcggctgtatggagcgattttgcagatgaggtcctgtaataaagagggatcc
gaacaagctcagaaagaaaatgaatttcaaggggccgaggccatggttctggagagcgtt
atgtttgccattctcgcagagaggtcacttgggccaaaactctatggcatctttccccaa
ggccgactggagcagttcatcccgagccggcgattagatactgaagaattaagtttgcca
gatatttctgcagaaatcgccgagaaaatggctacatttcatggtatgaaaatgccattc
aataaggaaccaaaatggctttttggcacaatggaaaagtatctaaaggaagtgctgaga
attaaatttactgaggaatccagaattaaaaagctccacaaattgctcagttacaatctg
cccttggaactggaaaacctgagatcattgcttgaatctactccatctccagttgtattt
tgtcataatgactgtcaagaaggtaatatcttgttgctggaaggccgagagaattctgaa
aaacagaaactgatgctcattgatttcgaatacagcagttacaattacaggggattcgac
attggaaatcacttctgtgagtggatgtatgattatagctatgaaaaatacccttttttc
agagcaagcatccggaagtatcccaccaagaaacaacagctccattttatttccagttac
ttgcctgcattccaaaatgactttgaaaacctcagtactgaagaaaaatccattataaaa
gaagaaatgttgcttgaagttaataggtttgcccttgcatctcatttcctctggggactg
tggtccattgtacaagccaagatttcatctattgaatttgggtacatggactacgcccaa
gcaaggtttgatgcctatttccaccagaagaggaagcttggggtgtga

DBGET integrated database retrieval system