KEGG   Pan troglodytes (chimpanzee): 451448Help
Entry
451448            CDS       T01005                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 819 aa AA seqDB search
MDKILEAVVTSSYPVSVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGAEELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGPRALACVQLGLQLLPEGPAADEV
FALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLTKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPRMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFGFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRVERQEEGKE
GRTEKEEVGEEEESTRGEEEREKEEVEEEEEKVEKETEKEAEQEKEEDSLGAGTHPDAAI
PSGERTCGSEGSRSVLDLVNYFLSPEKLTAENRYYCESCASLQDAEKVVELSQGPRYLIL
TLLRFSFDLRTMRRRKILDDVSIPLLLRLPLAGGRGQAYDLCSVVVHSGVSSESGHYYCY
AREGAARPAPSLGTTDRPEPENQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQR
PREGPEAESGSSRVRTEPTLHKDLMEAISKDNILYLQVS
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcttggaggcggtggtgacgtcgtcatacccggtcagcgtgaagcagggg
ctggttcggcgcgtgctggaggcggcgcggcagccgctggagcgtgagcagtgcctggcg
ctgctggcgctgggcgcgcgcctctacgtgggcggcgcggaggagctgccgcgccgcgtg
ggctgccagctgctgcacgtggccggccgccaccaccccgacgtcttcgccgagttcttc
agcgcgcgtcgcgtgctgcgcctgctgcagggtggcgccggccccccgggcccccgcgcg
ctcgcctgcgtgcagctgggtctgcagctgctgcccgaggggcctgcggccgacgaggtg
ttcgcgctgctgcggcgcgaggtgctgcgcaccgtgtgcgagcgcccggggcccgcggct
tgcgcgcaggtggcacggctgctggctcgccacccgcgctgtgtgcccgacggaccccac
cgcctgctcttctgccagcagctggtgcgttgcctcggccgcttccgctgcccagccgaa
ggcgaggagggcgccgtggagttcctagagcaggcccagcaggtgagcgggctcctggcg
cagctgtggcgcgcacagcccgccgccatcctgccctgcctcaaagagctgttcgcagtc
atctcctgcacagaggaggagccaccatctagcgccctggccagcgtggtccagcacctc
ccattggagctcatggatggtgttgtccggaacctcagcaatgatgacagtgtgacagac
tcgcagatgctgactgccattagcaggatgattgactgggtgtcctggcccctggggaag
aatattgacaagtggatcattgcactgctgaagggcctggctgccgttaagaagttcagc
atcttgatcgaggtttcgctcaccaaaattgagaaggttttctctaagctgctgtacccc
atcgtccggggagctgccttgtctgtgctcaagtacatgctcctgaccttccagcactcc
cacgaagccttccacctgctcctccctcacatcccccgcatggtggcctctctggtcaag
gaggactcgaactcggggaccagctgcctggagcagctggcggagctggtccactgcatg
gtgttccggttcccgggcttcccggatctgtatgagcctgtcatggaggccatcaaggac
ctccatgttcccaatgaggaccgcatcaagcagctgctggggcaggatgcctggacttcg
cagaagagcgagctggcgggtttctatccccggctcatggccaagtcagacacgggcaag
attggtctcatcaacctgggcaacacatgctatgtcaacagcatccttcaggccttattc
atggcgtctgacttcagacattgtgtgctccgcttgactgagaacaactcacagcccctg
atgaccaagctgcagtggctctttggcttcctagaacacagccagcggcctgccatttcc
ccagagaacttcctctccgcatcctggacgccctggttcagccctggcacccagcaggac
tgctcggagtatctgaagtacctgctggatcgggtagagaggcaggaagaagggaaggag
gggagaacggagaaggaagaagtgggggaggaggaggaaagcaccagaggggaagaagag
agggagaaagaggaggtggaagaggaagaagagaaggtggagaaggagacagaaaaggag
gctgagcaggaaaaggaagaagacagcctgggagcggggacccacccggatgctgccatc
ccctccggggagcggacatgtggctctgagggctcccgctccgtcctggacctggttaac
tacttcctgtcccccgagaagctgacagcagaaaaccgctactactgcgagtcgtgtgcc
tccctgcaggatgccgagaaggtggtggagctgagccaagggccgcgctacctcatcctc
acactgctgcgcttctccttcgacctgcgcaccatgcggcgccgcaagatcctggatgac
gtctccatccccctgctgctccgcctgccactggctggtggccgtggccaggcctatgac
ctctgcagtgtggtggtgcactctggagtgtcttcggagagtggtcactactactgctat
gcccgtgagggcgctgcccgccctgccccttctctgggaactaccgataggccagagccc
gagaaccagtggtacctgttcaatgacactcgggtgtccttctcttccttcgaatctgtc
agcaacgtcacttccttcttccctaaggacacagcctatgtgctgttttaccggcagcgg
cccagggaggggcccgaggctgagtcgggctcttctagagtccggacagagcccaccctg
cacaaggacttgatggaagccatttccaaagacaacatcctttacctacaggtgagctga

DBGET integrated database retrieval system