KEGG   Pan troglodytes (chimpanzee): 451473Help
Entry
451473            CDS       T01005                                 

Gene name
TYR
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00350  Tyrosine metabolism
ptr01100  Metabolic pathways
ptr04916  Melanogenesis
Module
ptr_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    451473 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    451473 (TYR)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     451473 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF LapA_dom DUF1191
Motif
Other DBs
NCBI-GeneID: 451473
NCBI-ProteinID: XP_001136041
Ensembl: ENSPTRG00000004155
Position
11
AA seq 571 aa AA seqDB search
MLLAALYCLLWSFQTSTGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRIWSWLLG
AAMVGAVLTALLAGLVSLLCRHKRKQLPEEKQPLLMEKXGLPQLVSEPFIKGLGNRVGPK
XPDLTLTQSNVQVPENICWYFSVKTICKIVT
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctttgtactgcctgctgtggagtttccagacctccactggccatttc
cctcgagcctgtgtctcctctaagaacctgatggagaaggaatgctgtccaccgtggagc
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccgcttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatcttcgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactatgtcatccccatagggacctatggccaaatgaaa
aatggatcaacacccatgtttaacgacatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccttggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaacgcccgagggacctttacggcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgatgtagaattt
tgcctgagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttt
agaaatacactggaaggatttgctagtccacttactgggatagcggatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccagaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttataccactgtacagaaatggtgatttctttatt
tcatccaaagatctgggctatgactatagctatctacaagattcagacccagactctttt
caagactacattaagtcctatttggaacaagcaagtcggatctggtcatggctccttggg
gcggcgatggtaggggccgtcctcactgccctgctggcagggcttgtgagcttgctgtgt
cgtcacaagagaaagcagcttcctgaagaaaagcagccactcctcatggagaaangagga
ttaccacagcttgtatcagagccatttataaaaggcttaggcaatagagtagggccaaaa
nagcctgacctcactctaactcaaagtaatgtccaggttccagagaatatctgctggtat
ttttctgtaaagaccatttgcaaaattgtaacctaa

DBGET integrated database retrieval system