KEGG   Pan troglodytes (chimpanzee): 451620Help
Entry
451620            CDS       T01005                                 

Gene name
GRIK4, GluK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    451620 (GRIK4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    451620 (GRIK4)
Ion channels [BR:ptr04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   451620 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 956 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcctgcgtggctcgtgatggttgcctgc
agcccgcactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgtgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgctgtcctcgggccatcgtccagc
ccagcctccagctccatcatcagcaacatctgtggagagaaggaggtccctcacttcaaa
gtggccccagaggagttcgtcaagttccagttccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctgctccgg
caattccttatctccaaggacacgctgtccgtccgcatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagaccgccaccatcatcatccacgccaac
gcctccatgtcccacaccatcctcctgaaggcagccgaacttgggatggtgtcagcctat
tacacatacatcttcactaatctggagttctcactccagagaatggacagccttgtggat
gatcgtgtcaacatcctgggattttccattttcaaccaatcccatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctctcctcggccctgctgtttgatgctgtctatgctgtggtgactgcggtgcag
gaactgaaccggagccaagagatcggcgtgaagcccctgtcttgcggctcggcccagatc
tggcagcacggcaccagcctcatgaactacctgcgcatggtagaattggaaggtcttacc
ggccacattgaattcaacagcaaaggccagaggtccaactacgccttgaaaatcttacag
ttcacaaggaatggttttcggcagatcggccagtggcacgtggcagagggcctcagcatg
gacagccgcctctatgcctccaacatctcggacactctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccga
ttcaactacaagatccgcctggttggggatggcgtgtacggcgttcccgaggccaacggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagatctggctgtggcaggc
ctcaccattacagctgaacgggagaaggtgattgatttctctaagccattcatgactctg
ggaattagcattctttaccgcgttcatatgggacgcaaacccggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgctcctagcctatctggccgtcagctgt
gtcctcttcctggtggctcggttgacgccctacgagtggtacagcccacacccatgtgcc
cagggccggtgcaacctcctggtgaaccagtactccctgggcaacagcctctggtttccg
gtcggggggttcatgcagcagggctccaccatcgcccctcgcgccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaacctg
gcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgaatatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctaccagacctaccaacgcatgtggaattacatgtattccaagcagcccagc
gtgttcgtgaagagcacagaggagggaatcgccagggtgttgaattccaactacgccttc
ctcctggaatccaccatgaacgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctcggttttccgg
gacgagtttgatctggccattctccagctgcaggagaacaaccgcctggagatcctgaag
cgcaaatggtgggaaggagggaagtgccccaaggaggaagatcacagagctaaaggcctg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctcagacactcagaagcaactgaggtgtcc
gtctgccaggagatggtgaccgagctgcgcagcattatcctgtgtcaggacagtatccac
ccccgccggcggcgcgccgcagtcccgccgccccggccccccatccccgaggagcgccga
ccccggggcacggcgacgctcagcaacgggaagctgtgcggggcaggggagcccgaccag
ctcgcgcagagactggcgcaggaggccgccctggtggcccgcggctgcacgcacatccgc
gtctgccccgagtgccgccgcttccagggcctgcgggcacggccgtcgcccgcccgcagc
gaggagagcctggagtgggagaaaaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system