KEGG   Pan troglodytes (chimpanzee): 451799Help
Entry
451799            CDS       T01005                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00051  Fructose and mannose metabolism
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01200  Carbon metabolism
ptr01230  Biosynthesis of amino acids
Module
ptr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ptr_M00002  Glycolysis, core module involving three-carbon compounds
ptr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    451799 (TPI1)
   00051 Fructose and mannose metabolism
    451799 (TPI1)
   00562 Inositol phosphate metabolism
    451799 (TPI1)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     451799 (TPI1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   451799 (TPI1)
  Exosomal proteins of bladder cancer cells
   451799 (TPI1)
  Exosomal proteins of melanoma cells
   451799 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 451799
NCBI-ProteinID: NP_001065250
Ensembl: ENSPTRG00000004595
UniProt: P60175
Position
12
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttggggggaactggaagatgaacgggcggaagcag
agtctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgactttgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcttttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcatcggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttcgagcagacaaaggtcatcgcagataacgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggctgaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgacgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system