KEGG   Pan troglodytes (chimpanzee): 451799Help
Entry
451799            CDS       T01005                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    451799 (TPI1)
   01230 Biosynthesis of amino acids
    451799 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    451799 (TPI1)
   00051 Fructose and mannose metabolism
    451799 (TPI1)
   00562 Inositol phosphate metabolism
    451799 (TPI1)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     451799 (TPI1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   451799 (TPI1)
  Exosomal proteins of bladder cancer cells
   451799 (TPI1)
  Exosomal proteins of melanoma cells
   451799 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttggggggaactggaagatgaacgggcggaagcag
agtctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgactttgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcttttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcatcggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttcgagcagacaaaggtcatcgcagataacgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggctgaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgacgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system