KEGG   Pan troglodytes (chimpanzee): 451863Help
Entry
451863            CDS       T01005                                 

Gene name
PFKM
Definition
phosphofructokinase, muscle
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    451863 (PFKM)
   01230 Biosynthesis of amino acids
    451863 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    451863 (PFKM)
   00030 Pentose phosphate pathway
    451863 (PFKM)
   00051 Fructose and mannose metabolism
    451863 (PFKM)
   00052 Galactose metabolism
    451863 (PFKM)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    451863 (PFKM)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    451863 (PFKM)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    451863 (PFKM)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     451863 (PFKM)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     451863 (PFKM)
Messenger RNA biogenesis [BR:ptr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     451863 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 851 aa AA seqDB search
MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPPKTDILKSLDTMDDPDTV
GSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEAAV
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagacgagtttcatctgaaatttttcatgtgtgtgattcaatctcgccagtta
gtcaggactcctcagagaacagctggggaagcttctacttccagcatgctcataccaaag
ccaccaccaaagacagacatcttgaagagtctagatactatggatgatccagacaccgtg
ggaagcatacctgttttcaaaactgagtggatcatgacccatgaagagcaccatgcagcc
aaaaccctggggattggcaaagccattgctgtcttaacctctggtggagatgcccaaggt
atgaatgctgctgtcagggctgtggttcgagttggtatcttcaccggtgcccgtgtcttc
tttgtccatgagggttatcaaggcctggtggatggtggagatcacatcaaggaagccacc
tgggagagcgtttcgatgatgcttcagctgggaggcacggtgattggaagtgcccggtgc
aaggactttcgggaacgagaaggacgactccgagctgcctacaacctggtgaagcgtggg
atcaccaatctctgtgtcattgggggtgatggcagcctcactggggctgacaccttccgt
tctgagtggagtgacttgttgagtgacctccagaaagcaggtaagatcacagatgaggag
gctacgaagtccagctacctgaacattgtgggcctggttgggtcaattgacaatgacttc
tgtggcaccgatatgaccattggcactgactctgccctgcaccggatcatggaaattgta
gatgccatcactaccactgcccagagccaccagaggacatttgtgttagaagtaatgggc
cgccactgtggatacctggcccttgtcacctctctgtcctgtggggccgactgggttttt
attcctgaatgtccaccagatgacgactgggaggaacacctttgtcgccgactcagcgag
acaaggacccgtggttctcgtctcaacatcatcattgtggctgagggtgcaattgacaag
aatggaaaaccaatcacctcagaagacatcaagaatctggtggttaagcgtctgggatat
gacacccgggttactgtcttggggcatgtgcagaggggtgggacgccatcagcctttgac
agaattctgggcagcaggatgggtgtggaagcagtgatggcacttttggaggggacccca
gataccccagcctgtgtagtgagcctctctggtaaccaggctgtgcgcctgcccctcatg
gaatgtgtccaggtgaccaaagatgtgaccaaggccatggatgagaagaaatttgacgaa
gccctgaagctgagaggccggagcttcatgaacaactgggaggtgtacaagcttctagct
catgtcagacccccggtatctaagagtggttcgcacacagtggctgtgatgaacgtgggg
gctccggctgcaggcatgaatgctgctgttcgctccactgtgaggattggccttatccag
ggcaaccgagtgctcgttgtccatgatggtttcgagggcctggccaaggggcagatagag
gaagctggctggagctatgttgggggctggactggccaaggtggctctaaacttgggact
aaaaggactctacccaagaagagctttgaacagatcagtgccaatataactaagtttaac
attcagggccttgtcatcattgggggctttgaggcttacacagggggcctggaactgatg
gagggcaggaagcagtttgatgagctctgcatcccatttgtggtcattcctgctacagtc
tccaacaatgtccctggctcagacttcagcgttggggctgacacagcactcaatactatc
tgcacaacctgtgaccgcatcaagcagtcagcagctggcaccaagcgtcgggtgtttatc
attgagactatgggtggctactgtggctacctggctaccatggctggactggcagctggg
gccgatgctgcctacatttttgaggagcccttcaccattcgagacctgcaggcaaatgtt
gaacatctggtgcaaaagatgaaaacaactgtgaaaaggggcttggtgttaaggaatgaa
aagtgcaatgagaactataccactgacttcattttcaacctgtactctgaggaggggaag
ggcatcttcgacagcaggaagaatgtgcttggtcacatgcagcagggtgggagcccaacc
ccatttgataggaattttgccactaagatgggcgccaaggctatgaactggatgtctggg
aaaatcaaagagagttaccgtaatgggcggatctttgccaatactccagattcgggctgt
gttctggggatgcgtaagagggctctggtcttccaaccagtggctgagctgaaggaccag
acagattttgagcatcgaatccccaaggaacagtggtggctgaaactgaggcccatcctc
aaaatcctagccaagtacgagattgacttggacacttcagaccatgcccacctggagcac
atcacccggaagcggtccggggaagctgctgtctaa

DBGET integrated database retrieval system