KEGG   Pan troglodytes (chimpanzee): 451866Help
Entry
451866            CDS       T01005                                 

Gene name
ADCY6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Purine metabolism
Rap1 signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ptr00230]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ptr04015]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ptr04114]
Cellular Processes; Cell communication; Gap junction [PATH:ptr04540]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:ptr04062]
Organismal Systems; Endocrine system; Insulin secretion [PATH:ptr04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ptr04912]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:ptr04913]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:ptr04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ptr04914]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:ptr04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ptr04918]
Organismal Systems; Endocrine system; Melanogenesis [PATH:ptr04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:ptr04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:ptr04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:ptr04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:ptr04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:ptr04972]
Organismal Systems; Digestive system; Bile secretion [PATH:ptr04976]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:ptr04962]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:ptr04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:ptr04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:ptr04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:ptr04725]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:ptr04723]
Organismal Systems; Sensory system; Taste transduction [PATH:ptr04742]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ptr04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:ptr04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:ptr05032]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:ptr05414]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ptr05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1118 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTVVLLAFHAAPARPHPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQERLQLSVLPQHV
AMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFAR
FDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVN
MRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEV
EPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAF
SRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLL
TFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLI
AVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIR
TCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVF
LHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAG
RVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHN
ILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNE
IIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQM
KHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTT
DLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacagtggtgctgctggctttccacgccgcacccgcccgccctcaccctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgctctcgcagcagacccgcgcagcccctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacacgctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcaggagcggctgcagctgtcggtattgccccagcacgtt
gccatggagatgaaagaagacatcaacacaaaaaaagaagacatgatgttccacaagatc
tacatacagaagcatgacaatgtcagcatcctgtttgcagacattgagggcttcaccagc
ctggcatcccagtgcaccgcgcaggagttggtcatgaccctgaatgagctctttgcccgg
tttgacaagctggctgcggagaatcactgcctgaggatcaagatcttgggggactgttac
tactgtgtgtcagggctgccggaggcccgggccgaccatgcccactgctgtgtggagatg
ggggtagacatgatcgaggccatctcgctggtacgtgaggtgacaggtgtgaatgtgaac
atgcgcgtgggcatccacagcgggcgcgtgcactgcggcgtccttggcttgcggaaatgg
cagttcgatgtgtggtccaatgatgtgaccctggccaaccacatggaggcaggaggccgg
gctggccgcatccacatcactcgggcaacactgcagtacctgaacggggactacgaggtg
gagccaggccgtggtggcgagcgcaacgcgtacctcaaggagcagcacattgagactttc
ctcatcctgggcgccagccagaaacggaaagaggagaaggccatgctggccaagctgcag
cggactcgggccaactccatggaagggctgatgccgcgctgggtgcctgatcgtgccttc
tcccggaccaaggactccaaggccttccgccagatgggcattgatgattccagcaaagac
aaccggggcacccaagatgccctgaaccctgaggatgaggtggatgagttcctgagccgt
gccatcgatgcccgcagcattgatcagctgcggaaggaccatgtgcgccggtttctgctc
accttccagagagaggatcttgagaagaagtactcccggaaggtggatccccgcttcgga
gcctacgttgcctgtgccctgttggtcttctgcttcatctgcttcatccagcttctcatc
ttcccacactccaccctgatgcttgggatctatgccagcatcttcctgctgctgctaatc
gccgtgctgatctgtgccgtgtactcctgtggttctctgttccctaaggccctgcaacgt
ctgtcccgcagcattgtccgctcacgggcacatagcaccgcagttggcatcttttccgtc
ctgcttgtgtttacttctgccattgccaacatgttcacctgtaaccacacccccatacgg
acctgtgcagcccggatgctgaatttaacacctgctgacatcactgcctgccacctgcag
cagctcaattactctctgggcctggatgctcccctgtgtgagggcaccatgcccacctgc
agctttcctgagtacttcatcgggaacatgctgctgagtctcttggccagctctgtcttc
ctacacatcagcagcatcgggaagttggccatgatctttgtcttggggctcatctatttg
gtgctgcttctgctgggtcccccagccaccatctttgacaactatgacctactgcttggc
gtccatggcttggcttcttccaatgagacctttgatgggctggactgtccagctgcaggg
agggtggccctcaaatatatgacccctgtgattctgctggtgtttgcgctggcgctgtat
ctgcatgctcagcaggtggagtcgactgcccgcctagacttcctctggaaactacaggca
acaggggagaaggaggagatggaggagctacaggcatacaaccggaggctgctgcataac
attctgcccaaggacgtggcggcccacttcctggcccgggagcgccgcaatgatgaactc
tactatcagtcgtgtgagtgtgtggctgttatgtttgcctccattgccaacttctctgag
ttctatgtggagctagaggcaaacaatgagggtgtcgagtgcctgcggctgctcaacgag
atcatcgctgactttgatgagattatcagcgaggagcggttccggcagctggaaaagatc
aagacgattggtagcacctacatggctgcctcagggctgaacgccagcacctacgatcag
gtgggccgctcccacatcactgccctggctgactacgccatgcggctcatggagcagatg
aagcacatcaatgagcactccttcaacaatttccagatgaagattgggctgaacatgggc
ccagtcgtggcaggtgtcatcggggctcggaagccacagtatgacatctgggggaacaca
gtgaatgtctctagtcgtatggacagcacgggggtccccgaccgaatccaggtgaccacg
gacctgtaccaggttctagctgccaagggctaccagctggagtgtcgaggggtggtcaag
gtgaagggcaagggggagatgaccacctacttcctcaatgggggccccagcagttaa

DBGET integrated database retrieval system