KEGG   Pan troglodytes (chimpanzee): 451873Help
Entry
451873            CDS       T01005                                 

Gene name
MLL2
Definition
histone-lysine N-methyltransferase MLL2-like
Orthology
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    451873 (MLL2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     451873 (MLL2)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    451873 (MLL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 649 aa AA seqDB search
MVNGVTPSEELGEHPKDAASARDSERALRDTSEVKSLDLLAALPTPPHNQTEDVRMESDE
DSDSPDSIVPASSPESILGEETPRFPHLGSGRWEQEDRALSPVIPLIPRASIPVFPDTKP
YGALDLEVPGKLPVTTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNSYEV
LFPESPARAGTEPKKGEAEGPGGKEKGLGGKSPDTGPDWLKQFDAVLPGYTLKSQLDILS
LLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPTEPLVELP
TEPLAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKWKGVRWKRLRLLLTIQ
KGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLW
VHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFAC
AIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM
FRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNG
RPEFVIKVIEQGLEDLVFTDASPQGEQWALEMDNMEWEKFLPGSLLQCL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatggcgtcaccccatctgaagagctgggggagcaccccaaggatgctgcctct
gcccgggatagtgaaagggcactgagggatacttcagaggtgaagagtctagacctgctg
gctgccttgcctacaccccctcacaatcagactgaggatgtcaggatggagagtgatgag
gatagcgattctcctgacagcattgtgccagcttcatcccctgagagcatcttgggggag
gagacccctcgtttccctcatctgggctcaggccggtgggagcaagaggaccgggccctc
tcccctgtcatccccctcattcctcgggccagcatcccagtcttcccagataccaaacct
tatggggcccttgacctggaggtccctggaaagctgcctgtcacaacttgggaaaagggc
aaaggaagtgaggtgtcagtcatgctcacagtctctgctgctgcagccaagaacctgaat
ggcgtgatggtggcagtggcggagctgctgagcatgaagatccccaactcctatgaggtg
ctgttcccagagagccccgcccgggcaggcactgagccaaagaagggggaagctgagggt
cctggtgggaaggaaaagggtctgggaggcaagagcccagacactggccctgattggctg
aagcagtttgatgcagtgttgcctggctataccctgaagagccaactagacatcttgagc
ctcctgaaacaggagagccccgccccagagccacccactcagcacagctatacctacaat
gtctccaatctggatgtgcgacagctctcggccccacctcctgaagaaccctccccgccc
ccttcccccttggcaccttctcctgccagtccccctactgagcccttggttgaacttccc
accgaacccttggctgagccacccgtcccctcacctctgccactggcctcatcccctgaa
tcagcccgacccaagccccgtgcccggccccctgaagaaggtgaagattcccgtcctcct
cgcctcaagaaatggaaaggagtgcgctggaagcggcttcggctgctgctgaccatccag
aagggcagtgggcggcaggaggatgagcgggaagtggcagagtttatggagcagcttggc
acagccttgcgacctgacaaggtaccgcgagacatgcgtcgctgctgtttctgtcatgag
gagggtgacggggccactgatgggcctgcccgtctgctgaacctggacctggacctgtgg
gtgcacctcaactgtgccctttggtccacggaggtgtatgagacccagggcggggcactg
atgaatgtggaggttgccctgcaccgaggactgctaaccaagtgctccctgtgccagcga
actggtgccaccagcagctgcaatcgcatgcgttgccccaatgtctaccattttgcttgt
gccatccgtgccaagtgcatgttcttcaaggacaagaccatgctgtgtccaatgcataag
atcaaggggccctgtgagcaagagctgagctcttttgctgtcttccggcgggtctacatt
gagcgggacgaggtgaagcaaatcgctagcatcattcagcggggagaacggctgcacatg
ttccgtgtggggggccttgtgttccacgccatcggacagctgctgcctcaccagatggct
gactttcatagtgccactgccctctatcccgtgggctacgaggccacgcgcatctattgg
agcctccgcaccaacaatcgtcgctgttgctatcgctgttctattggtgagaacaacggg
cggccggagtttgtaatcaaagtcatcgagcagggcctggaggacctggtcttcactgac
gcctctccccagggtgagcagtgggcccttgaaatggataatatggaatgggaaaagttt
ctcccagggtcactgttacaatgtctataa

DBGET integrated database retrieval system