KEGG   Pan troglodytes (chimpanzee): 451998Help
Entry
451998            CDS       T01005                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    451998 (GLS2)
   00330 Arginine and proline metabolism
    451998 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    451998 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    451998 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    451998 (GLS2)
   04727 GABAergic synapse
    451998 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    451998 (GLS2)
   05206 MicroRNAs in cancer
    451998 (GLS2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     451998 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 601 aa AA seqDB search
MRAECCLAHVSECRAGARRQSSPSLVLVCILGDAWVWNSLLPPVQVYWGLCVVFLRVLGS
DSSETGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQE
SSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAA
YIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKF
VGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGN
EYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGS
VMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAI
LLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGAE
VRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEA
CKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESM
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgagtgttgcttggctcacgtgtctgagtgcagggccggcgcacgccgccag
tcctcaccttccctagtcctcgtgtgtattttaggagatgcgtgggtgtggaacagcctc
ctgcctccggtccaggtgtactggggtctgtgtgttgtgtttctgcgtgttctcggcagt
gattcatcagaaactggcatgctgtcccgcctgggtgatttgctcttttacactattgct
gaaggacaggaacgaatccctatccacaagttcaccactgcactaaaggccactggactg
cagacatcagatcctcggctccgagactgcatgagcgagatgcaccgcgtggtccaagag
tccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaacatt
gtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttcacg
ggccatgtggatcgaatctttgaggatgtcaaagagctcactggaggcaaagtggcagcc
tacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcactgtg
gatggtcaacggcactctgtgggccacacaaagatccccttctgcctgcagtcctgtgtg
aagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaagttt
gtgggcaaagagccaagtggcctgcgctacaacaagctctccctcaatgaggaaggaatc
ccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatggac
tgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctgggaat
gaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcggaat
tatgccatcggctattatctcaaggaaaagaagtgctttcctaagggggtggacatgatg
gctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggcagt
gtcatggcagccaccctcgccaatggtgggatctgccccatcacaggcgagagtgtgctg
agtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgacttc
tctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagccatc
ctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccattggacaagctg
gggaacagccatagggggaccagcttctgccagaagttggtgtctctcttcaatttccac
aactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggcagaa
gttcggaacaagactgtggtcaacctgttatttgctgcctatagtggcgatgtctcagct
cttcgaaggtttgccttgtcagccatggatatggaacagaaagactatgactcgcgcaca
gctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgaggct
tgcaaagtgaatccttttgccaaggacaggtggggcaacattcccctggatgatgctgtg
cagttcaaccatctggaggtggtcaaactgcttcaagattaccaggactcctacacactc
tctgagactcaggctgaggcagcagctgaggccctgtccaaagagaacttagaaagcatg
gtatga

DBGET integrated database retrieval system