KEGG   Pan troglodytes (chimpanzee): 452025Help
Entry
452025            CDS       T01005                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    452025 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    452025 (CDK4)
   04115 p53 signaling pathway
    452025 (CDK4)
  Cellular commiunity
   04530 Tight junction
    452025 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    452025 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    452025 (CDK4)
   05203 Viral carcinogenesis
    452025 (CDK4)
   05212 Pancreatic cancer
    452025 (CDK4)
   05214 Glioma
    452025 (CDK4)
   05220 Chronic myeloid leukemia
    452025 (CDK4)
   05218 Melanoma
    452025 (CDK4)
   05219 Bladder cancer
    452025 (CDK4)
   05222 Small cell lung cancer
    452025 (CDK4)
   05223 Non-small cell lung cancer
    452025 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    452025 (CDK4)
   05162 Measles
    452025 (CDK4)
   05161 Hepatitis B
    452025 (CDK4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     452025 (CDK4)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   452025 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system