KEGG   Pan troglodytes (chimpanzee): 452035Help
Entry
452035            CDS       T01005                                 

Gene name
USP15
Definition
ubiquitin specific peptidase 15
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     452035 (USP15)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   452035 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 952 aa AA seqDB search
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPNVKNSNYCLPSYT
AYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFD
NPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLL
DGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCP
ECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTAL
SALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPV
CLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEG
SLHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDND
SENGLCTEDTCKGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFL
ALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYC
PNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPN
AGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLF
YQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHTN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagcggcggatctggacacccagcggtctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtacctagtcgatagtcgctggttcaaacag
tggaaaaaatatgttggctttgacagttgggacaaataccagatgggagatcaaaatgtg
tatcctggacccattgataactctggacttctcaaagatggtgatgcccagtcacttaag
gaacatcttattgatgaattggattacatactgttgccaactgaaggttggaataaactt
gtcagctggtacacattgatggaaggtcaagagccaatagcacgaaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctcacagaattgaagctatgtgaa
aatggaaacatgaataatgttgtaactcgaagatttagcaaagctgacacaatagataca
attgaaaaggaaataagaaaaatcttcaatattccagatgaaaaggagaccagattgtgg
aacaaatacatgagtaacacatttgaaccactgaataaaccagacagcaccattcaggat
gctggtttataccaaggacaggtattagtgatagaacagaaaaatgaagatggaacatgg
ccaaggggtccttctactcctaatgtgaaaaactcaaattactgtcttccatcttatact
gcttataagaactatgattattcggaacctggaagaaacaatgaacagccaggcctctgt
ggcctaagtaacttgggaaatacgtgtttcatgaactcagctattcagtgtttgagcaac
acacctccacttactgagtatttcctcaatgataagtatcaagaagaactgaattttgac
aatcccttaggaatgagaggtgaaatagctaaatcttatgccgaactgatcaagcaaatg
tggtctggaaagtttagctacgtcaccccaagagcctttaagacacaggtaggacgtttt
gcacctcagttctctggatatcagcagcaagactgtcaagaactgttagctttcctgtta
gatggattacatgaggatttgaatagaattaggaaaaaaccatatatacaattaaaagat
gcagatggaaggccagataaggtggttgccgaagaagcctgggaaaaccatttaaaacga
aatgattctatcatagtagatatatttcatggccttttcaaatcaactttagtttgtcct
gagtgtgctaagatttcagtaacatttgatcctttttgttacttgacacttccattgccc
atgaaaaaagaacgcaccttggaagtttacttagttagaatggatccgcttaccaaacct
atgcagtacaaagtggttgtccccaaaattggaaacatattagatctttgtacagcattg
tctgctttgtcaggaatacctgcagataagatgatagttactgatatatacaatcataga
tttcacagaatattcgctatggatgaaaaccttagtagtattatggaacgggatgatatt
tatgtgtttgaaattaacatcaataggacagaagatacagagcacgtgattattcctgtt
tgcctaagagaaaaattcagacactcgagttatacccaccatactggttcttcacttttt
ggtcagccctttcttatggctgtaccacgaaacaatactgaagacaaactttataatctc
ctgctcttgagaatgtgccgatatgtcaaaatatctactgaaactgaagaaactgaagga
tccctacactgctgtaaggaccaaaatattaatgggaatggcccaaatggcatacatgaa
gaaggctcaccaagtgaaatggaaacagatgagccagatgatgaatccagccaggatcaa
gaactcccctcagagaatgaaaacagtcagtctgaagattcagttggaggagataatgat
tctgaaaatggattatgtactgaggatacttgcaaaggtcaactcacgggacacaaaaaa
cgattgtttacattccagttcaacaacttaggcaatactgatatcaactacatcaaagat
gataccaggcatataagatttgatgataggcagcttaggctagatgaaagatcttttctt
gctttggattgggatcctgatttgaaaaaaagatattttgatgaaaatgccgctgaggac
tttgaaaaacatgaaagtgtggagtataaacctcctaaaaaaccctttgtgaaattaaaa
gattgcattgaactttttacaacaaaagaaaagctaggtgctgaagatccctggtattgt
ccgaattgtaaagaacatcagcaagccacaaagaaattggatttatggtccctgcctcca
gtacttgtagtacatctcaagcgattttcttacagtcgatacatgagagacaagttggat
accttagttgattttcctatcaatgacttggatatgtcggaattcttaattaatccaaat
gcaggtccttgccgctataatctgattgctgtttccaaccactatggagggatgggagga
ggacactatactgcttttgcaaaaaataaagatgatggaaaatggtactattttgatgac
agtagtgtctccactgcatctgaagaccaaatcgtgtccaaagcagcatatgtactcttc
taccagagacaagacactttcagtggaactggcttttttcctcttgaccgagaaactaaa
ggtgcttcagctgccactggcatcccattagaaagtgatgaagatagcaatgataatgac
aatgatatagaaaatgaaaactgtatgcacactaactaa

DBGET integrated database retrieval system