KEGG   Pan troglodytes (chimpanzee): 452061Help
Entry
452061            CDS       T01005                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     452061 (DYRK2)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   452061 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 601 aa AA seqDB search
MLTRKPSAAAPAAYPTGRGGDSAVRQLXASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaggaaaccttcggccgccgctcccgccgcctacccgaccggccgaggtggg
gacagcgccgttcgtcagcttnaggcttccccggggctcggtgcaggggctacccggagc
ggagtggggactggcccgccctcccccatcgccctgccgcctctccgggccagcaacgct
gccgccgcagcccacacgattggcggcagtaagcacacaatgaatgatcacctgcatgtc
ggcagccacgctcacggacagatccaggttcaacagttgtttgaggataatagtaacaag
cggacagtgctcacgacacaaccaaatgggcttacaacagtgggcaaaacgggcttgcca
gtggtgccagagcggcagctggacagcattcatagacggcaggggagctccacctctcta
aagtccatggaaggcatggggaaggtgaaagccacccccatgacacctgaacaagcaatg
aagcaatacatgcaaaaactcacagccttcgaacaccatgagattttcagctaccctgaa
atatatttcttgggtctaaatgctaagaagcgccagggcatgacaggtgggcccaacaat
ggtggctatgatgatgaccagggatcatatgtgcaggtgccccacgatcacgtggcttac
aggtatgaggtcctcaaggtcattgggaaggggagctttgggcaggtggtcaaggcctac
gatcacaaagtccaccagcacgtggccctaaagatggtgcggaatgagaagcgcttccac
cggcaagcagcggaggagatccgaatcctggaacacctgcggaagcaggacaaggataac
acaatgaatgtcatccatatgctggagaatttcactttccgcaaccacatctgcatgacg
tttgagctgctgagcatgaacctctatgagctcatcaagaagaataaattccagggcttc
agtctgcctttggttcgcaagtttgcccactcgattctgcagtgcttggatgctttgcac
aaaaacagaataattcactgtgaccttaagcccgagaacattttgttaaagcagcagggt
agaagcggtattaaagtaattgattttggctccagttgttacgagcatcagcgtgtctac
acgtacatccagtcgcgtttttaccgggctccagaagtgatccttggggccaggtatggc
atgcccattgatatgtggagcctgggctgcattttagcagagctcctgacgggttacccc
ctcttgcctggggaagatgaaggggaccagctggcctgtatgattgaactgttgggcatg
ccctcacagaaactgctggatgcatccaaacgagccaaaaattttgtgagctccaagggt
tatccccgttactgcactgtcacgactctctcagatggctctgtggtcctcaacggaggc
cgttcccggagggggaaactgaggggcccaccggagagcagagagtgggggaatgcgctg
aaggggtgtgatgatccccttttccttgacttcttaaaacagtgtttagagtgggatcct
gcagtgcgcatgaccccaggccaggctttgcggcacccctggctgaggaggcggttgcca
aagcctcccaccggggagaaaacgtcagtgaaaaggataactgagagcaccggtgctatc
acatctatatccaagttacctccaccttccagctcagcttccaaactgaggactaatttg
gcgcagatgacagatgccaatgggaatattcagcagaggacagtgttgccaaaacttgtt
agctga

DBGET integrated database retrieval system