KEGG   Pan troglodytes (chimpanzee): 452142Help
Entry
452142            CDS       T01005                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 712 aa AA seqDB search
MLAMDKCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYHCTTRSGRFL
RSAGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRRQELEYQVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENEISQKVSDSSVKQRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVRSRQSSLSSGLSGGA
SKGRKMELIQPKEPTSQYISLCHELHALFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQC
NSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPNEDADTSSNEILS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaatggataagtgcaaacatgttgggcagctgcagcttgctcaagaccattcc
agcctcaaccctcagaaatggcactgtgtggactgcaacacgaccgagtccatttgggct
tgccttagctgctcccatgttgcctgtggaagatatattgaagagcatgcactcaagcac
tttcaagaaagcagtcatcctgttgcattggaggtgaatgagatgtacgttttttgttac
ctttgtgatgattatgttctgaatgataatgcaactggagacctgaagttactacgaagt
acattaagtgccatcaaaagtcaaaattatcactgcacaactcgtagtgggaggttttta
cggtccgcaggtacaggtgatgattcttatttcttacatgacggtgcccaatctctgctt
caaagtgaagatcaactgtatactgctctttggcacaggagaaggatactaatgggtaaa
atctttcgaacatggtttgaacaatcacccattggaagaaaaaagcaagaagaaccattt
caggaaaaaatagtagtaaaaagagaagtaaagaaaagacggcaggaattggagtatcaa
gttaaagcagaattggaaagtatgcctccaagaaagagtttacgtttacaagggctcgct
cagtcgaccataatagaaatagtttctgttcaggtgccagcacaaacgccagcatcacca
gcaaaagataaagtactctctacctcagaaaatgaaatatctcaaaaagtcagtgactcc
tcagttaaacaaaggccaatagtaactcctggtgtaacaggattgagaaatttgggaaat
acttgctatatgaattctgttcttcaggtgttgagtcatttacttatttttcgacaatgt
tttttaaagcttgatctgaaccaatggctggctatgactgctagtgagaagacaagatct
tgtaagcatccaccagtcacagatacagtagtatatcaaatgaatgaatgtcaggaaaaa
gatacaggttttgttcgctccagacaatcaagtctgtcatcaggactaagtggtggagca
tcaaaaggtagaaagatggaacttattcagccaaaggagccaacttcacagtacatttct
ctttgtcatgaattgcatgctttgttccaagtcatgtggtctggaaagtgggcgttggtc
tcaccatttgctatgctacactcagtgtggagactcattcctgcctttcgtggttacgcc
caacaagacgctcaggaatttctttgtgaacttttagataaaatacaacgtgaattagag
acaactggtaccagtttaccagctcttatccccacttctcaaaggaaactcatcaaacaa
gttctgaatgttgtaaataacatttttcatggacaacttcttagtcaggttacatgtctt
gcatgtgacaacaaatcaaataccatagaacctttctgggacttgtcattggagtttcca
gaaaggtatcaatgcagtggaaaagatattgcttcccagccatgtctggttactgaaatg
ttggccaaatttacagaaactgaagctttagaaggaaaaatctacgtatgtgaccagtgt
aactcaaagcgtagaaggttttcctccaaaccagttgtactcacagaagcccagaaacaa
cttatgatatgccacctacctcaggttctcagactgcacctcaaacgattcaggtggtca
ggacgtaataaccgagagaagattggtgttcatgttggctttgaggaaatcttaaacatg
gagccctattgctgcagggagaccctgaaatccctcagaccagaatgctttatctatgac
ttgtccgcggtggtgatgcaccatgggaaaggatttggctcagggcactacactgcctac
tgctataattctgaaggagggttctgggtacactgcaatgattccaaactaagcatgtgc
actatggatgaagtatgcaaggctcaagcttatatcttgttttatacccaacgagttact
gagaatggacattctaaacttttgcctccagagctcctgttggggagccagcatcccaat
gaagacgctgatacctcgtctaatgaaatccttagctga

DBGET integrated database retrieval system