KEGG   Pan troglodytes (chimpanzee): 452195Help
Entry
452195            CDS       T01005                                 

Gene name
ALDH1L2
Definition
(RefSeq) mitochondrial 10-formyltetrahydrofolate dehydrogenase isoform X1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    452195 (ALDH1L2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     452195 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 452195
NCBI-ProteinID: XP_001160213
Ensembl: ENSPTRG00000005382
UniProt: H2Q6R9
Position
12
AA seq 923 aa AA seqDB search
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYISKEVNEMMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcggggcagccaggcgctccggcgcttctccactggccgggtttatttcaaa
aacaagctgaagttggcactaattggccagagcctctttggacaagaagtctatagccac
ctccgcaaagagggccaccgagtagtaggggtgttcacagttccagacaaggatggaaaa
gctgaccctctggctttggctgcagagaaagatgggacccctgtgttcaagcttcctaaa
tggagggtcaagggcaagaccatcaaagaagtggcagaagcctacagatccgtgggtgca
gagctaaatgtgctccctttctgcactcagttcattcccatggatataattgatagtcca
aagcatggctctatcatttatcacccatccatcctgcccaggcacagaggagcctctgct
atcaattggactctaattatgggagataagaaagctgggttttctgttttctgggctgat
gatggcttggatacaggacccatccttcttcagagatcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtagaa
gctgtccaactcatagctgatggaaaagctcctcgtataccccagccagaagaaggggca
acatatgaaggtatccagaaaaaggaaaatgctgagatttcttgggaccagtctgctgaa
gttttacataactggattcgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcactttctatggctcgacattactgaatagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtctcgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgatggtgagaaatctgcagtttgaagatggaaaaatg
atccctgcctctcagtacttttcaacgggtgagacgtcagtggtagaactgacagctgaa
gaggtgaaagtggcagagaccattaaggtcatctgggctggaattttaagcaatgtcccc
attattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgccagg
ctggttgaagagatcagacagaaatgtggtgggcttcagttgcagaatgaagatgtctat
atggccaccaagtttgaagactttatccaaaaggtcgtgaggaaactgagaggagaagat
caagaggtggagctggttgtagattatatttcaaaggaggtcaatgaaatgatggtaaaa
atgccataccagtgtttcataaatggacagttcacagatgcagacgatggaaagacttac
gacactatcaacccaacagatggatctacaatatgcaaagtatcctacgcttctttggcg
gatgttgataaagcagtagcagcagcaaaagatgcttttgaaaacggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtatagacttgcagacctactggaagagaac
caagaagagctggcaactattgaagcccttgattcaggggctgtctataccttggccctg
aagacacacattggaatgtctgtgcaaacattcagatattttgctggctggtgtgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaagagccactcggtgtctgtgccattattattccctggaactacccgctgatgatg
ctggcatggaagagtgctgcgtgtttggcagcaggcaataccttagtgctcaagccagca
caggtcacgcccttgactgctttgaagtttgcagaactgtctgtgaaagcaggctttcca
aagggggtcatcaacatcattccaggctcaggtggcatagcaggacaacgtctgtctgaa
catcctgacatccgcaaacttggtttcactggttccactcctattggcaaacagatcatg
aagagctgtgctgttagcaacttgaagaaagtttcccttgagcttggtggcaagtctcca
cttataatatttaatgactgtgaacttgacaaggctgtgcgaatgggcatgggagcagta
tttttcaacaaaggagagaactgtattgctgctgggcggttgttcgtggaagaatccatc
cacgacgaatttgtgacaagagtggtagaagaaattaaaaagatgaaaattggtgatcca
cttgacagatccactgatcatgggccccaaaatcataaggcccatctggaaaagctgctg
caatactgtgaaactggagtgaaagaaggggccactttggtgtatgggggaagacaagtc
caaaggccaggctttttcatggagccgactgtgttcacagatgtggaagactacatgtac
cttgccaaagaggaatcctttgggcctattatggtcatttctaaattccaaaatggggac
atcgatggagtgttgcagcgagcaaatagtacagagtatggtttggcctcaggggttttt
acaagagacataaacaaagctatgtatgtgagtgaaaaactggaagcaggaactgttttt
attaacacatacaacaagacagatgtggcggccccatttggcggagttaaacaatctgga
tttggaaaagacttaggtgaggaagctctaaatgaatatctcaaaaccaagacggtgaca
ctggaatattag

DBGET integrated database retrieval system