KEGG   Pan troglodytes (chimpanzee): 452219Help
Entry
452219            CDS       T01005                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    452219 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    452219 (ACACB)
   00640 Propanoate metabolism
    452219 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    452219 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    452219 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    452219 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    452219 (ACACB)
Enzymes [BR:ptr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     452219 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     452219 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 2458 aa AA seqDB search
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANFIPSQEPFPASDNSGETPQR
NGEGHTLPKTPSQDEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
GTQGVEATDTNGLSSSARPEGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSV
AGSSRESTRKGSRASLGALSLEAYLTTGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
RISVPQDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAVRLAKTVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIAARITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMIMDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDHKDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctttgtctatcttgtctgattttctcctgtctgaccttttcctggtta
aaaatctgggggaaaatgacggactccaagccgatcaccaagagtaaatcagaagcaaac
ttcatcccgagccaggagccctttccagcctctgataactcaggggagacaccgcagaga
aatggggagggccacactctgcccaagacacccagccaggacgagccagcctcccacaaa
ggccccaaagatgccggtcggcggagaaactccctaccaccctcccaccagaagccccca
agaaaccccctttcttccagtgacgcagcaccctccccagagcttcaagccaacgggact
gggacacaaggtgtggaggccacagataccaatggcctgtcctcctcagccaggcccgag
ggccagcaagctggctccccctccaaagaagacaagaagcaggcaaacatcaagaggcag
ctgatgaccaacttcatcctgggctcttttgatgactactcctccgacgaggactctgtt
gctggctcatctcgtgagtctacccggaagggcagccgggccagcttgggggccctgtcc
ctggaggcttatctgaccacaggtgaagctgagacccgcgtccccactatgaggccgagc
atgtcgggactccacctggtgaagaggggacgggaacacaagaagctggacctgcacaga
gactttaccgtggcttctcccgctgagtttgtcacacgctttgggggggatcgggtcatc
gagaaggtgcttattgccaacaacgggatcgccgccgtgaagtgcatgcgctccatccgc
aggtgggcctatgagatgttccgcaacgagcgggccatccggtttgttgtgatggtgacc
cccgaggaccttaaggccaacgcagagtacatcaagatggcggatcattacgtccccgtc
ccaggagggcccaataacaacaactatgccaacgtggagctgattgtggacattgccaag
agaatccccgtgcaggcggtgtgggctggctggggccatgcttcagaaaaccctaaactt
ccggagctgctgtgcaagaatggagttgctttcttaggccctcccagtgaggccatgtgg
gccttaggagataagatcgcctccaccgttgtcgcccagacgctacaggtcccaaccctg
ccctggagtggaagcggcctgacagtggagtggacagaagatgatctgcagcagggaaaa
agaatcagtgtcccacaagatgtttatgacaagggttgcgtgaaagacgtggatgagggc
ttggaggcagcagaaagaattggttttccattgatgatcaaagcttctgaaggtggcgga
gggaagggaatccggaaggctgagagtgcggaggacttcccgatccttttcagacaagta
cagagtgagatcccaggctcgcccatctttctcatgaagctggcccagcacgcccgtcac
ctggaagttcagatcctcgctgaccagtatgggaatgctgtgtctctgtttggtcgcgac
tgctccatccagcggcggcatcagaagatcgttgaggaagcaccggccaccatcgccccg
ctggccatattcgagttcatggagcagtgtgccgtccgcctggccaagaccgtgggctat
gtgagtgcagggacggtggaatacctctatagtcaggatggcagcttctacttcttggag
ctgaatcctcgcttgcaggtggaacatccctgcacagaaatgattgctgacgttaatctg
ccggccgcccagctacagatcgccatgggcgtgccactgcaccggctgaaggatatccgg
cttctgtacggagagtcaccatggggagtgactcccatttcttttgaaaccccctcaaac
cctcccctcgcccgaggccacgtcattgccgccagaatcaccagcgaaaacccagacgag
ggttttaagccgagctccgggactgttcaggaactgaatttccggagcagcaagaacgtg
tggggttacttcagcgtggccgctgctggaggcctgcacgagtttgcggattcccagttt
gggcactgcttctcctggggagagaaccgggaagaggccatttcgaacatggtggtggct
ttgaaggaactgtccatccgaggcgactttaggactaccgtggaatacctcattaacctc
ctggagaccgagagcttccagaacaacgacatcgacaccgggtggttggactacctcatt
gctgagaaagtgcaggcggagaaaccggatatcatgcttggggtggtatgcggggccttg
aacgtggccgatgcgatgttcagaacgtgtatgacagatttcttacactccctggaaagg
ggccaggtcctcccagcggattcactactgaaccttgtagatgtggaattaatttacgga
ggcgttaagtacattctcaaggtggcccggcagtctctgaccatgttcgttctcatcatg
aacggctgccacatcgagattgatgcccaccggctgaatgatggggggctcctgctctcc
tacaatgggaacagctacaccacctacatgaaggaagaggttgacagttaccgaattacc
atcggcaataagacgtgtgtgtttgagaaggagaacgatcctacagtcctgagatccccc
tcggctgggaagctgacacagtacacagtggaggatgggggccacgttgaggctgggagc
agctacgctgagatggaggtgatgaagatgatcatgaccctgaacgttcaggaaagtggc
cgggtgaagtacatcaagcgtccaggtgccgtgctggaagcaggctgcgtggtggccagg
ctggagctcgatgacccttctaaagtccacccggctgaaccgttcacaggagaactccct
gcccagcagacactgcccatcctcggagagaaactgcaccaggtcttccacagcgtcctg
gaaaacctcaccaacgtcatgagtggcttttgtctgccagagcccgtttttagcataaag
ctgaaggagtgggtgcagaagctcatgatgaccctccggcacccgtcactgccgctgctg
gagctgcaggagatcatgaccagcgtggcaggccgcatccccgcccctgtggagaagtct
gtccgcagggtgatggcccagtatgccagcaacatcacctcggtgctgtgccagttcccc
agccagcagatagccaccatcctggactgccacgcagccaccctgcagcggaaggctgat
cgagaggtcttcttcatcaacacccagagcatcgtgcagttggtccagagataccgcagc
gggatccgcggctatatgaaaacagtggtgttggatctcctgagaagatacttgcgtgtt
gagcaccattttcagcaagcccactacgacaagtgtgtgataaacctcagggagcagttc
aagccagacatgtcccaggtgctggactgcatcttctcccacgcacaggtggccaagaag
aaccagctggtgatcatgttgatcgatgagctgtgtggcccagacccttccctgtcagac
gagctgatctccatcctcaacgagctcactcagctgagcaaaagcgagcactgcaaagtg
gccctcagagcccggcagatcctgattgcctcccacctcccctcctacgagctgcggcat
aaccaggtggagtccattttcctgtctgccattgacatgtacggccaccagttctgcccc
gagaacctcaagaaattaatactttcggaaacaaccatcttcgatgtcctgcctactttc
ttctatcacgcaaacaaagtcgtgtgcatggcgtccttggaggtttacgtgcggaggggc
tacatcgcctatgagttaaacagcctgcagcaccggcagctcccggacggcacctgcgtg
gtagaattccagttcatgctgccgtcctcccacccaaaccggatgaccgtgcccatcagc
atcaccaaccctgacctgctgaggcacagcacagagctcttcatggacagcggcttctcc
ccactgtgccagcgcatgggagccatggtagccttcaggagattcgaggacttcaccaga
aattttgatgaagtcatctcttgcttcgccaacgtgcccaaagacacccccctcttcagt
gaggctcgcacctccctgtactccgaggatgactgcaagagcctcagagaagagcctatc
cacattctgaatgtgtccatccagtgtgcagaccacctggaggatgaggcactggtgccg
attttacggacattcgtacagtccaagaaaaatatccttgtggattatggactccgacga
atcacattcttgattgcccaagagaaagaatttcccaagtttttcacattcagagcaaga
gatgagtttgcagaagatcgcatttaccgtcacttggaacctgccctggccttccagctg
gaactcaaccggatgcgtaacttcgatctgaccgccgtgccctgtgccaaccacaagatg
cacctttacctgggtgctgccaaggtgaaggaaggtgtggaagtgacggaccataggttc
ttcatccgcgccatcatcaggcactccgacctgatcacaaaggaagcctccttcgaatac
ctgcagaacgagggtgagcggctgctcctggaggccatggacgagctggaggtggcgttc
aataacaccagcgtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtc
atcatggaccccttcaagatcgaggagtccgtgcgctacatggttatgcgctacggcagc
cggctgtggaaactccgtgtgctacaggctgaggtcaagatcaacatccgccagaccacc
accggcagtgccgttcccatccgcctgttcatcaccaatgagtcgggctactacctggac
atcagcctctacaaagaagtgactgactccagatctggaaatatcatgtttcactccttc
ggcaacaagcaagggccccagcacgggatgctgatcaatactccctacgtcaccaaggat
ctgctccaggccaagcgattccaggcccagaccctgggaaccacctacatctatgacttc
ccggaaatgttcaggcaggctctctttaaactgtggggctccccagacaagtatcccaaa
gacatcctgacatacactgaattagtgttggactctcagggccagctggtggagatgaac
cgacttcctggtggaaatgaggtgggcatggtggccttcaaaatgaggtttaagacccag
gagtacccagaaggacgggacgtgatcgtcatcggcaacgacatcacctttcgcattgga
tcctttggccctggagaggaccttctgtacctgcgggcatccgagatggcccgggcagag
ggcattcccaaaatttacgtggcagccaacagtggcgcccgtattggcatggcagaggag
atcaaacacatgttccacgtggcttgggtggacccagaagacccccacaaaggatttaaa
tacctgtacctgactccccaagactacaccagaatcagctccctgaactccgtccactgt
aaacacatcgaggaaggaggagaatccagatacatgatcatggatatcatcgggaaggat
gatggcttgggcgtggagaatctgaggggctcaggcatgattgctggggagtcctctctg
gcttacgaagagatcgtcaccattagcttggtgacctgccgagccattgggattggggcc
tacttggtgaggctgggccagcgagtgatccaggtggagaactcccacatcatcctcaca
ggagcaagtgctctcaacaaggtcctgggaagagaggtctacacatccaacaaccagctg
ggtggcgttcagatcatgcattacaatggtgtctcccacatcaccgtgccagatgacttt
gagggggtttataccatcctggagtggctgtcctatatgccaaaggataatcacagccct
gtccctatcatcacacccactgaccccattgacagagaaattgaattcctcccatccaga
gctccctacgacccccggtggatgcttgcaggaaggcctcacccaactctgaagggaacg
tggcagagcggattctttgaccacggcagtttcaaggaaatcatggcaccctgggcgcag
accgtggtgacaggacgagcaaggcttgggggaattcccgtgggagtgattgctgtggag
acacggactgtggaggtggcagtccctgcagaccctgccaacctggattctgaggccaag
ataattcagcaggcaggacaggtgtggttcccagactcagcctacaaaaccgcccaggcc
atcaaggacttcaaccgggagaagttgcccctgatgatctttgccaactggagggggttc
tccggtggcatgaaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggac
ggccttagacaatacaaacagcccatcctgatctatatcccgccctatgcggagctccgg
ggaggctcctgggtggtcatagatgccaccatcaacccgctgtgcatagaaatgtatgca
gacaaagagagcaggggtggtgttctggaaccagaggggacagtggagattaagttccga
aagaaagatctgataaagtccatgagaaggatcgatccagcttacaagaagctcatggaa
cagctaggggaacctgatctctcggacaaggaccacaaggacctggagggccggctgaag
gctcgcgaggacctgctgctccccatctaccaccaggtggcagtgcagttcgccgacttc
cacgacacacctggccggatgctggagaagggcgtcatatctgacatcctggagtggaag
accgcacgcaccttcctgtattggcgtctgcgccgcctcctcctggaggaccaggtcaag
caggagatcctgcaggccagcggggagctgagtcacgtgcatatccagtccatgctgcgc
cgctggttcgtggagacggagggggctgtcaaggcctacttgtgggacaacaaccaggtg
gttgtgcagtggctggaacagcactggcaggcgggggatggcccgcgctccaccatccgt
gagaacatcacgtacctgaagcacgactctgtcctcaagaccatccgaggcctggttgaa
gaaaaccccgaggtggccgtggactgtgtgatatacctgagccagcacatcagcccagct
gagcgggcgcaggtcgttcacctgctgtctaccatggacagcccggcctccacctga

DBGET integrated database retrieval system