KEGG   Pan troglodytes (chimpanzee): 453319Help
Entry
453319            CDS       T01005                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    453319 (THBS1)
   04350 TGF-beta signaling pathway
    453319 (THBS1)
   04151 PI3K-Akt signaling pathway
    453319 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    453319 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    453319 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    453319 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    453319 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    453319 (THBS1)
   05205 Proteoglycans in cancer
    453319 (THBS1)
   05219 Bladder cancer
    453319 (THBS1)
  Infectious diseases
   05144 Malaria
    453319 (THBS1)
Heparan sulfate/heparin binding proteins [BR:ptr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  453319 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1170 aa AA seqDB search
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcgtcctgttcctgatgcatgtgtgtggcaccaaccgc
attccagagtctggcggagacaacagcgtgtttgacatctttgaactcaccggggccgcc
cgcaaggggtctgggcgccgactggtgaagggccccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gctgtgcgggcagaaaagggtttcctccttctggcatccctgaggcagatgaagaagacc
cggggcacgctgctggccctggagcggaaagaccactctggccaggtcttcagcgtggtg
tccaatggcaaggcgggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtg
gtgtctgtggaagaagctctcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgactgtgaaaagatggagaatgctgagttggac
gtccccatccaaagcgtcttcaccagagacctggccagcatcgccagactccgcatcgca
aaggggggcgtcaatgacaatttccagggggtgctgcagaatgtgaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtcctcctc
acccttgacaacaacgtggtgaatggttccagccctgccatccgcactaactacattggc
cacaagacaaaggacttgcaagccatctgcggcatctcctgtgatgagctgtccagcatg
gtcctggaactcaggggcctgcgcaccattgtgaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagttggccaatgagctgaggcggcctcccctatgctatcac
aacggagttcagtacagaaataacgaggaatggactgttgatagctgcactgagtgtcac
tgtcagaactcagttaccatctgcaaaaaggtgtcctgccccatcatgccctgctccaat
gccacagttcctgatggagaatgctgtcctcgctgttggcccagcgactctgcggacgat
ggctggtctccatggtctgagtggacctcctgttctacaagctgtggcaatggaattcag
cagcgcggccgctcctgcgacagcctcaacaaccgatgtgagggctcctcggtccagaca
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggtggctggagccac
tggtccccgtggtcatcttgttctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaacgggaaaccctgtgaaggcgaagcgcgggag
accaaagcctgcaagaaagacgcctgccccatcaatggaggctggggtccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagtcgtctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtaacagaaaaccagatc
tgcaacaagcaggactgtccgattgatggatgcctgtccaatccctgctttgccggcgtg
aagtgtactagctaccctgatggcagctggaaatgtggtgcttgtccccctggttacagt
ggaaatggcatccagtgcacagatgttgatgagtgcaaagaagtgcctgatgcctgcttc
aaccacaatggagagcaccggtgtgagaacacggaccccggctacaactgcctgccctgc
cccccacgcttcaccggctcacagcccttcggccagggtgtcgaatatgccacggccaac
aaacaggtgtgcaagccccgtaacccctgcacggatgggacccacgactgcaacaagaac
gccaagtgcaactacctgggccactatagcgaccccatgttccgctgcgagtgcaagcct
ggctacgctggcaatggcatcatctgcggggaggacacagacctggatggctggcccaat
gagaacctggtgtgcgtggccaatgcgacttaccactgcaaaaaggataattgccccaac
cttcccaactcagggcaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gacgatgacaatgataaaattccagatgacagggacaactgtccattccattacaaccca
gctcagtatgactatgacagagatgatgtgggagaccgctgtgacaactgtccctacaac
cacaacccagatcaggcagacacagacaacaatggggaaggagacgcctgtgctgcagac
attgatggagacggtatcctcaatgaacgggacaactgccagtacgtctacaatgtggac
cagagagacactgatatggatggggttggagatcagtgtgacaactgccccttggaacac
aatccggatcagctggactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaatctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaac
gatggcattcctgatgacagggacaactgcagactcgtgcccaatcccgaccagaaggac
tctgacggcgatggtcgaggtgatgcttgcaaagatgattttgaccatgacagtgtgcca
gacatcgatgacatctgtcctgagaatgttgacatcagtgagaccgatttccgccgattc
cagatgattcctctggaccccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggactcgctgtaggttat
gatgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgaaagggacgat
gactatgctggatttgtctttggctaccagtctagcagccgcttttatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagggctcagggatactcgggc
ctttctgtgaaagttgtaaactccaccacagggcctggcgagcacctgcggaacgccctg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctcagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgat
aaaacctatgctggtggtagactagggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgtagagatccctaa

DBGET integrated database retrieval system